KEGG   Maylandia zebra (zebra mbuna): 101482443Help
Entry
101482443         CDS       T02814                                 

Gene name
pigt
Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    101482443 (pigt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 101482443
NCBI-ProteinID: XP_004554210
UniProt: A0A3P9CWK2
Position
LG20
AA seq 643 aa AA seqDB search
MAAHRCSCWSWLLILFSLSVFVVADIHETTPVNDHHGGVDHNAQTAEQTADQPAVEERRW
EATEVKEAATVDAAADIQGTSAPETVVPSSVPQPKDDFQEELVIRPLHSGDIYASFQFRT
LWDTDFMRENKVSHYRLFPKSLGQVISKFSVRELHISFTQGYWRTMQWGQPFIPSPPGAE
LWVWFQDSVTDVDATWKELTNVLSGIFCASLNFIDSTNTVQPSASFKPLGLGNVTDHSFL
RYATLPREIVCTENLTPWKKLLPCGSKAGLAVLLKSEKLFHSSFHSQAVHIRSVCQDWQC
KTTSWELRQTLNSVFDLHNSGQTKREWSLFKMFSRTLTEACPLASSSKLYIDITDNPQGE
QFELSPATSLLSQAVVLGDRRTFSVYDLTQETTFGTVRSLNLLIRWKSNEGEMLRPLLHA
ERYVAGYGLQTGEIHTLMYNNHPYRSFPVLLLDSVPWYLRLYIHTLSVTSKGKDNKPSYI
HYEPSKDRVKPHLLEMLIQLPPNSVTEVTVQFERALLKWTEYPPDPNHGFYVGSSVISSL
VPSTVAMHTNSTRERPLFSSFFPCKEESSYFVRIYTEPLLVNLPTPDFSMPYNVICLTCT
VVAVGYGSLYNLLTRSFQIEEPNPGLAKRIANVIRRMRGVPPL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcacaggtgcagctgctggtcttggctgcttattctttttagtttgtccgtg
tttgttgtcgcagacattcatgaaacgacgccagttaatgaccaccacggtggggttgac
cataatgcacaaacagcggaacaaacggctgaccagcccgcggtggaggagagacggtgg
gaagcaaccgaggttaaagaagccgctacggttgatgctgcagccgacattcagggcact
tctgcacctgaaacagtggtaccttcgtcggtaccacagcctaaagacgacttccaagaa
gagctggtcatcagacctctgcactccggagatatttatgccagcttccagttccgcacc
ctgtgggacacagacttcatgagagaaaacaaagtgtcccactaccggcttttccccaag
tctctgggccaggtcatctccaagttctcagtcagagaactgcacatctcttttacacaa
ggttactggaggaccatgcagtgggggcaaccctttataccatccccacctggagctgag
ctctgggtctggttccaagactcagtgacagatgtcgatgctacatggaaggagctaacc
aatgttttgtcaggcatcttctgtgcatcactgaacttcattgactccaccaacactgtt
cagcccagtgcctccttcaaacccctgggactaggcaacgtgacagaccacagcttcctt
cgctatgccaccctcccacgagaaattgtttgcacagagaatttgacaccctggaagaaa
ctcttgccatgtggatccaaggctggtctcgctgtccttttgaagtcagagaaactcttc
cacagcagttttcattcccaggcagtgcacatcaggtccgtgtgtcaggactggcagtgc
aaaaccacatcctgggagctgagacagacgttgaattcagtctttgacctgcacaactct
ggacagaccaaacgagagtggtctttgttcaagatgttctctcggaccctgacagaagct
tgtccgttggcctcctccagtaaattatatatcgacatcacagacaaccctcagggggag
cagtttgagctcagcccagccacttccctgctgagccaggcagtggtgctgggagacaga
cggaccttctctgtgtacgatctgacccaagaaaccacctttggcactgtgcgctccctc
aacctgctgattcgatggaagtccaatgagggtgaaatgctgcgtcccttgctccatgct
gagcgttatgtggctggatacgggctgcagacaggagagattcacacattaatgtacaac
aaccacccatataggtctttccctgtactgctgctggactcggtaccttggtatcttcgt
ctctacatccacacgctcagtgtgacgagcaagggaaaggacaacaagcccagctacatc
cactacgagccatctaaggaccgtgtgaagccccacctgctggagatgctgatccagctt
cctccaaactctgtgactgaggttacagtgcagtttgagagggctctgctcaaatggact
gaatacccacccgatcccaaccacggtttctatgtcggatcttcagttattagttctctt
gtaccaagcactgtcgccatgcatacaaacagcactcgggaacgaccacttttcagcagc
ttttttccctgtaaagaagagtccagctactttgtccgcatctacacagagcctctgctt
gtcaatctgcccactccagacttcagcatgccttacaatgtcatctgcctcacatgcact
gtagtggctgtgggctacggctctctatacaacttactaacgcggagcttccagatcgaa
gagcccaacccaggactggccaagcggatcgctaacgtcatccgaaggatgaggggcgtc
ccgccactctga

DBGET integrated database retrieval system