KEGG   Maylandia zebra (zebra mbuna): 101482904Help
Entry
101482904         CDS       T02814                                 

Gene name
dusp10
Definition
(RefSeq) dual specificity protein phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101482904 (dusp10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mze01009]
    101482904 (dusp10)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101482904 (dusp10)
    3.1.3.48  protein-tyrosine-phosphatase
     101482904 (dusp10)
Protein phosphatases and associated proteins [BR:mze01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    101482904 (dusp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Init_tRNA_PT Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 101482904
NCBI-ProteinID: XP_004550490
UniProt: A0A3P9AUY6
Position
LG15
AA seq 472 aa AA seqDB search
MPPSPLDDRIVVALPRPIRPQELQLRLDTSYLDSITTSSIDKTVISTTVVKIRATANLVT
YMPSSKGSTRSLSCGCSSASCCSVTTYEKDSQSLSHSQVSASSPNLSYAGPPTPMVSSHE
ALSAPSLAPGTPKALATVRVIHPNELAKRITCCPMGHPVGPVPVIIDCRPFMEYNKSHIR
GAVHINCSDKISRRRLQQGKITVLDLISCREGKDSFKGIFSKEIVVYDESTTDPNRLTST
QPLHVVLESLRREGKDPIILKGGLSSFRQSHENLCEHSLHLHEGLDTGAAAGLTGALPHS
LPSTPDIENAELTPILPFLYLGNEHDAQDIKLLQRLNIGYILNVTTHLPLYHYDTGLFVY
KRLPATDSNKQNLRQYFEEAFEFIEEAHQSGMGLLIHCQAGVSRSATIVIAYLMKHTWMT
MTDAYKFVKTRRPIISPNLNFMGQLLEFEDDLNSGITPRILTPKLIGVETVV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatctcccctcgacgacagaattgtggtggcgctgccaaggccaatccgacct
caggaactccaactacgcctggacaccagctacctggactccatcaccaccagcagcatc
gacaagaccgtaatcagcaccaccgtggtgaagatccgggcgacggccaatcttgtaacg
tatatgccctcatccaagggctccacgcgctcattgtcgtgtggatgcagcagtgccagc
tgctgctctgtcacaacctatgagaaggacagccagagcctcagccacagccaggtgagc
gccagtagccccaatctcagctacgccgggccccctaccccaatggtcagcagccatgaa
gcattaagtgcccccagtctcgcccctggcacaccgaaggccctagccaccgtgagggtc
atccaccccaatgagctggccaagcggataacctgctgtcccatgggtcaccctgtgggg
cccgtgccggtcatcattgactgccggcccttcatggagtacaacaagagccacatccgg
ggggccgtgcacattaactgctctgacaagatcagccggagacggctgcagcagggcaag
atcactgtgctggacctcatttcctgccgtgagggcaaggactcttttaagggcatcttc
tctaaagagattgtggtttatgatgagagcaccacagacccgaaccggctgacatccact
cagcctctacatgtggtcctggaatcactgaggagggagggcaaggacccaatcatcctc
aaaggaggccttagcagcttcaggcagagccatgaaaacctgtgtgagcactcgctgcac
cttcacgaaggcttggacacgggcgcagctgctggcctgacgggggctctacctcactcc
ctgccctccaccccggacatagagaacgcagagctgacgccaatcctgcccttcctctac
ctggggaacgagcacgacgctcaggacatcaaactgctgcagcgcttgaacatcggctac
atcctaaatgtaaccacccacctgccgctctaccactatgacacgggcctctttgtctac
aagcgcctgcctgccaccgacagcaacaagcagaacctgcggcagtactttgaggaggcg
tttgaattcattgaggaagcacaccaatcgggtatgggcctcctgatccactgccaggca
ggcgtgtctcgttcagccaccattgtgatcgcctacctgatgaagcacacctggatgacc
atgacggacgcctacaagtttgtcaaaaccaggaggcccatcatctccccgaaccttaac
ttcatgggccagctgctggagtttgaggacgacctcaacagtggaataacgccacgaatc
ctcacgccaaagttgattggtgtggaaaccgtcgtctag

DBGET integrated database retrieval system