KEGG   Maylandia zebra (zebra mbuna): 101485424Help
Entry
101485424         CDS       T02814                                 

Gene name
abhd6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mze01002]
    101485424 (abhd6)
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101485424 (abhd6)
Peptidases [BR:mze01002]
 Serine Peptidases
  Family S33
   101485424 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Esterase UPF0227 DUF2048 Ndr Esterase_phd Abhydrolase_3 Lipase
Motif
Other DBs
NCBI-GeneID: 101485424
NCBI-ProteinID: XP_024658112
Position
LG5
AA seq 339 aa AA seqDB search
MELNVAKMIMLAGGVLVVPVLAFVTSFLFWPGALLKAYNWYWRRRLGLVVRFSHSGNYHF
CYSTRGAPGGATPSLLLLHGFSATKDMWLPVVKFLPRNQHVVCVDMPGHEGTSRTGPEDY
SIRGQVERIHQFVQSIGLDKRPFHLVGTSMGGNVAGVYAATYPTHLSSVTLVCPAGLVYP
TDSEFISRLRELEMGEKDESIPLVPTTIQELEDMLRLCCNTPPKLPRQVLSGLLANRIPN
NDFYKEVFMEIVGEKSRHSLQENMHLITVPLQVIWGKEDQVLDVSGAAVLQGALPHCQVT
VLDSCGHSVALERPRKAAKLITDFLSEQAVSDGNVKKVS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaatgtggccaaaatgataatgctggcaggaggtgtcctggttgtgcccgtg
ctcgctttcgtcacctccttcctgttctggcctggagcgctcctcaaggcgtacaactgg
tattggcgccgcaggctcggattggttgtccgcttctctcacagtgggaattaccacttc
tgttattccacacgcggggcaccaggaggcgcaacaccatcactgctgctgctccacggc
ttctctgccaccaaggatatgtggctacctgttgtcaagttcctccctagaaaccaacat
gtggtgtgtgtggacatgccgggacacgaggggacaagtcgcaccggtccagaggattac
agcatccgcggtcaggttgaacgaatccaccagtttgtgcagagtatcggtctcgataaa
agacccttccacctggtcggcacgtcaatgggtggcaacgtcgcaggggtgtacgctgcc
acttaccccacccacctatccagtgtcaccttggtttgcccggcaggcctggtttacccg
acggactcggagttcatcagtcgcctgagggagctggagatgggtgagaaggatgagtcg
atcccgctcgtccccaccaccattcaggaactcgaggacatgctgagactctgttgtaac
acccccccaaaactcccccgacaggtgctgagcggtctccttgccaacaggatcccaaac
aatgatttctacaaagaagtgttcatggagattgttggggagaagtctcgccactcgcta
caagaaaacatgcatctgatcacagtgcccctgcaggttatctgggggaaggaagaccag
gtgctggacgtttcgggcgccgctgtgctgcagggggcgctgcctcactgccaggtgacg
gtgttggacagctgtggtcactctgtggctcttgagcgaccgagaaaggccgccaaactc
atcacggacttcctgtctgagcaggcagtcagcgatggcaacgtaaagaaagtttcttga

DBGET integrated database retrieval system