KEGG   Maylandia zebra (zebra mbuna): 101485501Help
Entry
101485501         CDS       T02814                                 

Definition
(RefSeq) alanine aminotransferase 2-like isoform X1
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00220  Arginine biosynthesis
mze00250  Alanine, aspartate and glutamate metabolism
mze01100  Metabolic pathways
mze01200  Carbon metabolism
mze01210  2-Oxocarboxylic acid metabolism
mze01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mze00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101485501
   00220 Arginine biosynthesis
    101485501
Enzymes [BR:mze01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101485501
Amino acid related enzymes [BR:mze01007]
 Aminotransferase (transaminase)
  Class I
   101485501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 101485501
NCBI-ProteinID: XP_004542940
Position
LG18
AA seq 560 aa AA seqDB search
MSAARMQVLSSRNVRLLSRGRNEVFAGRSGAQRPGGDPRTRSLTCPPLSSSSSPGRALSS
LSATRRGLPKEKMSENGIMSRAKVLTIDTMNPTVKKVEYAVRGPIVQRAVELERELSEGM
KKPFAEVIKANIGDAHAMGQQPITFFRQVLALCSYPELLSDSTFPEDAKSRACRILQSCG
GNSMGSYSASQGIDSVRQDVARYIERRDGGVACDPDNIYLTTGASDGIVTMLKLLVCGEG
TTRTGVMIPIPQYPLYSAALAELGAVQINYFLNEEKCWSLDITELQRAVNEARQYCNPRA
LCIINPGNPTGQVQSRQCIEDVIRFAAKERLFLMADEVYQDNVYAEGCQFHSFKKVLFEM
GPEYAETVELASFHSTSKCYMGECGFRGGYMEIINMDDEVKDQLTKLLSVRLCPPVPGQA
LMDLVVNPPQPGEPSYGSFIKERTATLSALAEKAKLTEQVLNTVQGISCNPVQGAMYSFP
RITIPEKAVKEATETGQQPDMFYCMKMLEETGICLVPGSGFGQKDGTYHFRMTILPPTDK
LKILLNKVKEFHQRFTQQYS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccgctcggatgcaggtgctctcctccagaaacgtccggcttttaagccgcggg
cggaacgaggtgtttgccggtagaagcggagcgcagcggcccggcggagaccccaggacc
cgctcactgacttgtccccctctgtcatcctcctcttctcccggcagagccctatcgagt
ttgagtgcgacgcggcgtggacttcccaaagagaaaatgtccgagaatgggatcatgtcc
cgggccaaggtgctgaccatcgacaccatgaaccccacggtgaagaaggtggagtacgcc
gtgcggggacccatcgtacagcgcgccgtggagctagagagggagctctcagagggaatg
aagaagccctttgcagaggtcattaaggccaacattggtgacgcgcacgctatgggccag
cagccaatcactttcttccgacaggtcctggcgctctgctcctaccctgaactgctgagt
gacagcacattcccagaggatgctaaaagtagagcatgccgcattctgcagtcttgtggc
gggaacagtatgggttcctacagtgccagtcaaggcatagactctgtgcgtcaggacgtg
gcccgttacattgaacgacgggatggcggtgtggcctgtgacccagataacatttatctc
accacaggagccagcgacggcattgtgacaatgctgaagctgctggtgtgtggcgaaggt
acaacccgtaccggtgttatgatacccatacctcagtatcccctgtattcagctgcactg
gccgaactgggcgctgtgcagatcaactatttccttaatgaggaaaagtgctggagcctg
gacatcactgagctgcagcgtgctgtaaatgaggccaggcagtactgcaacccccgagcc
ttatgcatcatcaaccctggaaaccccacaggtcaggttcagagcagacagtgcattgag
gatgtaattcgattcgctgcaaaggaacgtctctttctcatggctgatgaggtgtaccag
gataatgtgtatgctgagggatgccagttccactcttttaagaaggtcctgtttgagatg
gggcccgagtacgcagaaacagtggaactggcgtctttccactcaacctctaagtgttac
atgggagagtgcggttttcgtgggggctacatggaaatcatcaacatggacgatgaagtg
aaggaccagctcaccaagctgctgtcagttcgtctgtgccctcctgttcctggtcaggct
ctaatggacctggtggttaaccctccacagcctggggaaccttcttatggcagctttatc
aaggaacgcacagccacattaagtgccttagcagaaaaggccaaacttacagagcaagtt
ctcaacacggtccaaggcatcagctgcaaccctgtgcagggtgctatgtactcctttcct
cgcataaccatccctgaaaaggctgtcaaagaggccacggaaacgggacagcagccagac
atgttttattgcatgaagatgttggaggaaacgggaatctgcctcgtacctggcagtggc
tttggccaaaaagatgggacctaccatttcagaatgaccatcttgccaccgaccgacaag
ctgaagatcctcctcaataaagtcaaagagttccaccagagattcacccagcaatattct
taa

DBGET integrated database retrieval system