KEGG   Maylandia zebra (zebra mbuna): 101487130Help
Entry
101487130         CDS       T02814                                 

Gene name
cwc27
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CWC27 homolog
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
mze  Maylandia zebra (zebra mbuna)
Brite
KEGG Orthology (KO) [BR:mze00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mze03041]
    101487130 (cwc27)
   03110 Chaperones and folding catalysts [BR:mze03110]
    101487130 (cwc27)
Enzymes [BR:mze01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101487130 (cwc27)
Spliceosome [BR:mze03041]
 Complex C
  Other components
   PPlases
    101487130 (cwc27)
Chaperones and folding catalysts [BR:mze03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    101487130 (cwc27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 101487130
NCBI-ProteinID: XP_012778928
UniProt: A0A3P9BI04
Position
LG7
AA seq 482 aa AA seqDB search
MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFVQLCMEGYYDGTVFHRVVPD
FIVQGGDPTGTGAGGESIYGRPFKDEFHSRLRFNRRGLVAMANAGPHDNGSQFFLTLGRA
DELNNKHTIFGKVTGDTVYNMLRLAEVECDGEERPLNPHKIKSAEVLHSPFDDIIPREIK
KLKKEKDKEETKKSQSKATKNFSLLSFGEEAEEDEEMVNQVSQTFKGKSKSSHDLLKDDP
RLSSVPAVDKGKKKKASASGDAALSGDEADDDVEDDMDTDEEYDSEKKEKIRELISKKLK
KEKGGEKVAEPSEEEQEKKMSRSDELRKEARQLKKELQAIKQRKEESSKPAKDEVKEVEK
KPTSEAVAEYLEGRKKYEGLKNRKLKKGSSREEQTLALLNSFKSKLSSAITEGPQEDMEE
LAEDDDKGWMAHVLQFDEQSRKVKDANMQDEDTFEIYDPRNPVNKRRREESKKILKEKKA
KR
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacatttacattcaagagccaccaacaaatgggaaggtcctgttaaagacaaca
gcaggtgatattgacattgagttgtggtccaaggaggctcctaaagcatgcaggaacttc
gtgcagctgtgcatggaaggttattatgatggtacagtgttccacagagtggtgcctgat
ttcatcgttcaggggggagatcctactgggacaggggcaggcggagagtccatctatggc
cgaccattcaaggatgagtttcactctaggttgcgcttcaatcggaggggtttggttgcc
atggcaaatgcagggccacatgacaatggcagtcagttttttctcaccttgggacgtgca
gatgaactcaacaataaacataccatatttggcaaggtcactggagacaccgtgtataac
atgctcagattagcagaagttgagtgtgatggtgaggaaagacctctgaatcctcacaag
atcaaatctgctgaggtgttacattctccatttgatgacatcatacctcgtgaaataaag
aaactcaaaaaggaaaaggataaagaagagacgaagaaatcacagtcaaaagccacaaag
aatttcagtcttttatcatttggagaggaagctgaagaagatgaggagatggtgaaccaa
gtcagccagacattcaagggaaaaagcaaaagcagccatgaccttttgaaagatgatccc
agactgagctctgttccagcagttgataagggtaagaagaaaaaagcatctgcatctggt
gatgcagctttgtcaggtgacgaggctgacgatgatgttgaggacgacatggacacagat
gaggaatatgactcggagaagaaagagaagatcagagagctcataagtaaaaagctaaag
aaggaaaagggtggagagaaagtggcagagcccagtgaagaggagcaagaaaaaaagatg
agccgcagtgatgaattacggaaagaggcgcgacagttgaagaaagaactgcaggccata
aagcaaagaaaagaagaaagttcaaaacctgcaaaagatgaagtcaaggaggtggagaaa
aagccaaccagtgaagctgtggctgagtacttggagggaagaaagaaatatgaagggctc
aagaaccgaaaactgaaaaaaggctcaagcagagaagaacagacgctggccctgctcaac
agcttcaagtccaagctgtcatcggccatcactgagggtccacaggaggacatggaggag
ctggcagaggatgatgacaaaggatggatggcccatgttctgcagtttgatgagcaaagc
agaaaagtcaaggatgccaacatgcaggatgaggacacctttgagatctatgacccacgc
aaccccgttaacaaacgcaggagagaggagagtaagaagatcctgaaagaaaagaaggcc
aagaggtga

DBGET integrated database retrieval system