KEGG   Maylandia zebra (zebra mbuna): 112429926Help
Entry
112429926         CDS       T02814                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00010  Glycolysis / Gluconeogenesis
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112429926
   00562 Inositol phosphate metabolism
    112429926
Enzymes [BR:mze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     112429926
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     112429926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 112429926
NCBI-ProteinID: XP_024657141
Position
Unknown
AA seq 517 aa AA seqDB search
MLFGRPAHRKNRRLKVTQTRNINKARKAEAGGPRLSPRLSSPVPADMFSVFHPAGGVLLA
SLGLLVPRLSFASLSVPDIPHIAGYFGTKTRYEEVNPHLLRDPLSADPSVLRPPPAEQCS
PVHLTAVIRHGSRYPTLKNIRRIRKLSELVRTEASRASGGSESWLQEIRNRWEAWYTEDM
DGQLVMKGRDDLRQLASRLASVFPSLLSEESVRKRRVRFLTSSKHRCVSSVEAFQEGLQR
RWGCHDGEPEYSHEVDDELMRFFDRCRGYVEGVENNRTALLEVEKFKHGEEMEGVRRRMA
DRLGLPHHRLTPDLLEAAFFLCSYELSIKNVHSPWCFLFDESDAKVLEYKSDLKQYWKRS
HGHEINSLSSCPLFHHVFRTLDRAGRPRRSTDASPEPASILVGHAETLLPLLSLLGLYKD
QTPPTATNYDSQHGRRFRTSLIVPYAANLLFVLYDCQRGPRLQLLVNESPVRFPGLEAED
APLYRDVRATYRHLLDGCDFHRECEGRAVGRAPNTEL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctttttggtcggcccgcacaccggaaaaacaggaggttaaaggtcacacaaacccgg
aacatcaacaaagcaagaaaggcggaagcaggtggaccccgtctgtctccccggctcagt
tctccggtccccgccgacatgttctccgtgtttcaccccgctggaggtgtgctgctggcc
agtctgggtctgctcgtgccccgcctgtccttcgcctccctgtcggtcccggacatcccg
cacatcgccgggtacttcggcaccaagacccggtacgaggaggtgaacccgcacctgctg
cgggaccctctgtccgcggacccttcggtcctgagaccgcccccggccgagcaatgctcc
ccggtccacctcaccgccgtcatccgacacggcagccgctacccgacccttaagaacatc
cgcaggatccggaaactgagcgagctggtccggaccgaagcttccagggcctccggcgga
tctgagagctggctgcaggagatccggaaccgctgggaggcgtggtacaccgaggacatg
gacggtcagctggtgatgaagggccgggatgacctgcgtcagctggcgagccgcctggcg
tctgtgttcccatctctgctgtccgaggagagtgtgaggaagaggagggtgcgcttcctg
accagctcgaagcatcgctgcgtgagcagcgtggaggcgtttcaggaggggctgcagcgc
cgctggggatgccacgatggcgagccggagtacagccacgaggtggacgatgagttgatg
cgtttctttgaccgttgccgtggttatgtggagggcgtggagaacaaccgcacggcgctg
ctggaggtggagaagttcaaacatggcgaggagatggagggagtgaggaggaggatggcc
gacaggctgggccttcctcaccaccgactcacaccagatctgctggaggcggcgttcttc
ttgtgctcgtacgagctctccatcaaaaacgtgcactcgccgtggtgcttcctgtttgac
gagagcgacgcaaaggtgttggagtacaagtcggacttgaagcagtactggaagcgttcg
cacggccacgagatcaacagcctgtccagctgcccgctcttccatcacgtcttcaggacg
ctggacagagccggtcgtcctcgcaggtccactgacgcgtccccagagcccgcctccatc
ttggtgggtcatgctgagacgctcctccccctcctctctctgctgggactctacaaggac
caaactccacccactgccaccaactacgactcacagcatggtcgccgtttccggaccagt
ctcatcgtgccatacgccgccaacctgctgttcgtgctgtacgactgccagcgaggccca
cggctgcagctacttgtcaatgagtcgccagttcgattccccgggctggaggcggaggat
gcgccgctgtaccgtgacgtccgggcaacgtaccgccacctgctggacggctgcgacttc
catagagagtgcgaggggagggcggtgggccgagcgcccaacacggagctctga

DBGET integrated database retrieval system