KEGG   Maylandia zebra (zebra mbuna): 112432874Help
Entry
112432874         CDS       T02814                                 

Definition
(RefSeq) glutamate receptor 1-like
  KO
K05197  glutamate receptor 1
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mze00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112432874
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mze04040]
    112432874
Ion channels [BR:mze04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   112432874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan-Glu_bd SBP_bac_3 Lig_chan
Motif
Other DBs
NCBI-GeneID: 112432874
NCBI-ProteinID: XP_024657073
Position
Unknown
AA seq 495 aa AA seqDB search
MVDTSSSFAMTYAFCSQFSKGVYAIMGLYDRRTVNMLMSFCGSLHVCFVTPSFPVQTNNQ
FVLQLRPQLQEPLMALLEHFYWTRFVYMYSSESGLAVLQRILDTAAERSWQVTSVNLDSL
TEPAFIKLLADLDYKKDFQIIIDCELKRLNYILNLIAAQKRNLKNYHYILANLGFLDLNV
TEFQKLGPNVTGFQLVNRSDPAVQKINQNWLDFDNKDLKVARRRLKYTGALTYDGVSVMA
TAFQNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRLEGLTGHVQFDERGHR
TNYTLTVMELSHIGPRKIGFWNEKRGYVNTAIYRPMQEEFYNVQNKTYIVTTILEAPYMM
LKKNHEQFWGNDKYEGYCAELAAEIAKHVGFTYRLELVGDGKYGARDAETKMWNGMVGEL
VYGKADMAVAPLTITLVREQVIDFTKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWM
CIVFAYIGVSVVLFL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggtggacacgagcagcagtttcgccatgacctacgccttctgctcacagttctctaag
ggagtgtacgccatcatgggtctgtacgaccggcggacggtcaacatgctgatgtccttc
tgcgggtctctgcacgtctgcttcgtcacgccgtccttccccgtgcagaccaacaaccag
ttcgtcctgcagctgcggccccagctgcaggagcccctcatggccctgctcgagcacttc
tactggaccaggttcgtctacatgtacagctctgaatcaggtttggcagtgttgcagagg
atcctggacacggcggcagaacgaagttggcaggtcacctcggttaacctggacagtctc
acagagccggccttcatcaagctgctggctgacctcgactacaagaaggacttccagatc
atcatcgactgcgagctgaaacgcctcaactacatcctcaacctgattgctgctcagaag
aggaacttgaagaactaccactacatccttgccaatctgggcttcttggacctgaacgtc
acagaatttcagaagctcggaccgaacgtgaccggcttccaactggtgaatcggtcggat
cccgctgtgcagaagatcaatcagaactggctggacttcgacaacaaagacctcaaagtg
gctcgcaggaggctcaagtacacaggagctctgacctatgatggtgtcagcgtcatggca
acggcattccagaatctgcggaggcaacggatcgacatctctcgccggggcaacgcaggg
gagtgcctggccaacccgcccgctccgtggggacagggcatcgatatccagagagccctg
cagcaggttcgtctggaggggctgacgggtcacgtccagttcgatgagcgcggacatcga
accaactacactttgactgtgatggagctcagccacattggacccaggaagatcggcttc
tggaatgagaagagaggctatgtgaacactgccatctacaggccgatgcaggaggagttt
tacaatgtgcagaacaaaacctacatcgtcactaccatcctggaagctccctacatgatg
ctaaagaagaaccacgagcagttttggggaaacgataaatatgaaggttactgtgccgag
ctcgccgcagagatcgccaaacacgtcgggttcacgtaccgccttgagctagtaggtgac
ggcaagtacggtgccagagacgctgaaacaaagatgtggaatggcatggtgggagagctg
gtgtatgggaaggcggacatggcagtggccccgctgaccatcactctggtgcgagagcag
gtgatcgacttcacaaaacccttcatgtctctgggaatctccatcatgatcaagaaacct
accaagtccaaaccaggcgtcttctctttcctcgacccgctggcctacgagatctggatg
tgcatcgtctttgcctacatcggggtcagcgtggtgctcttcctg

DBGET integrated database retrieval system