KEGG   Maylandia zebra (zebra mbuna): 112434824Help
Entry
112434824         CDS       T02814                                 

Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta-like
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
mze  Maylandia zebra (zebra mbuna)
Pathway
mze00562  Inositol phosphate metabolism
mze01100  Metabolic pathways
mze04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:mze00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112434824
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    112434824
Enzymes [BR:mze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     112434824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX PI3_PI4_kinase C2
Motif
Other DBs
NCBI-GeneID: 112434824
NCBI-ProteinID: XP_024658248
Position
LG5
AA seq 430 aa AA seqDB search
MLKTSGHMFHIDFGKFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDLC
CEAYNLIRKHTHLFLNLLGLMLSCGIPELSDLDDLKYVYDALRPHESEADATMYFTRLIE
SSLGSVATKLNFFIHNLAQMKFTSSEERPTLSFAPRFHSAKSDGIIKNLYICRHIRTGGK
GYAFVVKVEREGQQEVQLVQRTFEEFQELHSKLRLIFPSSKLPSFPSRFVIGRSRSEAMA
DRRKDELNGYVWHLIHAAPEVAQCDLVYTFFHPLPKDERSGTTASKPAEISWSPGSGKEL
GEVKLSISYKNEKLFIMVIHIRGLQPLQDGTDPDPYVKLYLLPDPQKMSKRKTKAARRTC
NPTYNEMLVYERIPRGDLDQRVIHLRVLGDGAFWENTLLGETFIPLKRLVPGQHWVGWHK
LGPPGSDFAH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagacgagcgggcacatgttccacatcgacttcgggaagttcctgggacacgcc
cagatgttcgggaacatcaaacgggaccgcgcccccttcgtcttcacctctgatatggct
tatgtcatcaatggcggcgacaagccgtccagccgcttccacgactttgtggatctgtgc
tgcgaagcatacaacctgatccggaaacacactcacctgttcctcaacctgctgggcctg
atgttgtcctgtgggatcccggagctctccgacctcgatgacctgaagtatgtctatgat
gcactgagacctcacgagtctgaggctgacgccaccatgtacttcaccaggttgatcgag
tccagtctgggcagcgttgccaccaaactgaacttcttcatccacaatctggcccagatg
aagttcacctcgtcggaggagcgccccacgctgtcgttcgcccccaggttccactcggca
aagagcgacggcatcatcaagaacctgtacatctgcagacacatccggaccggcggaaag
ggatatgcttttgtggtgaaggtggagcgtgaaggtcagcaggaggtgcagctggttcag
aggacatttgaagagtttcaggaactccacagcaaactgaggctcatcttcccctcatcc
aaactgcccagtttccccagtcgctttgtgattggccgttcccgcagcgaggcgatggct
gacaggaggaaggacgagctgaacggttacgtgtggcacttgatccacgccgctccggag
gtcgctcagtgtgacctggtgtacaccttcttccacccgctgcccaaagacgagcgatca
ggaacgacggcgagcaaaccagcagagatctcgtggtctccaggttcaggaaaagagctc
ggcgaggtcaaactgtccatctcctacaagaatgaaaaactcttcatcatggtgatacac
atccgaggcctgcagcccctgcaggatgggactgaccccgacccctacgtgaagctctat
ctcctccccgaccctcagaagatgagcaagaggaaaacgaaggcggcgcgacgcacgtgc
aacccgacctacaatgagatgctggtgtacgagcggatcccacggggggacctggaccag
agggtgatccaccttcgggtcctgggagacggcgccttctgggagaacacgctgctggga
gagaccttcatccccctgaagaggctggtcccaggtcagcactgggtgggctggcacaaa
ctgggcccccctggctcagacttcgcccactga

DBGET integrated database retrieval system