KEGG   Methanosalsum zhilinae: Mzhil_0540Help
Entry
Mzhil_0540        CDS       T01541                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00260  Glycine, serine and threonine metabolism
mzh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mzh01100  Metabolic pathways
mzh01110  Biosynthesis of secondary metabolites
mzh01130  Biosynthesis of antibiotics
mzh01230  Biosynthesis of amino acids
Module
mzh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mzhil_0540
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mzhil_0540
Enzymes [BR:mzh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mzhil_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO PcrB BtpA ThiG FMN_dh IMPDH
Motif
Other DBs
NCBI-ProteinID: AEH60410
UniProt: F7XQ49
Position
complement(587636..588418)
Genome map
AA seq 260 aa AA seqDB search
MRISDKFEELKSRNEGALISYICAGDPSTELTKSAVEALVRGGADIIELGLPFSDPCADG
PVIQSATDRAISAGMTPDRYFELVSTLQVDIPLVCMTYYNIIYKRGIEKFIEDCSSSGIT
GLIVPDLPVEESDELGLACEKNEVDLIFLIAPTTNKKRLQKILSKSTGFLYMVSRTGVTG
GSTDINTGIADLLTDIKKCANIPIAVGFGISNRNQVVDIISYGADGVIAGSAFVDIIASG
KNVEHRLESLVFDLKSGCKE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagaatatctgataaattcgaagagctaaaatcaagaaatgaaggtgccctgatatcc
tatatctgtgcaggagatccatctactgaattgacaaaatctgcagttgaagcattggta
aggggtggagcagatatcattgaactcgggcttccattttccgatccctgtgccgacggg
cctgtaatacagtcagcaacagatagagcaatatcagcaggaatgacacctgacagatat
tttgaacttgtgtctacccttcaggttgatattccacttgtctgtatgacatactacaat
ataatatacaaacgcggtattgaaaaatttatagaagactgttcttcttccggtataaca
ggtcttattgtcccagatctgcctgttgaggaatctgatgaactcgggctcgcgtgtgaa
aagaatgaagtggacctgatattccttatagcaccaacaacaaataagaaaaggcttcag
aaaatactttctaagagcacaggctttctatatatggtatcccggacaggcgtcacaggt
ggaagtactgatatcaatactggtatagcagatctgcttacagatatcaaaaagtgcgca
aatatccccattgcagtcgggtttggcatatcaaaccgcaatcaagtagtggatattatt
tcatacggagccgatggagttattgcgggatctgcatttgtagatattattgcatcagga
aaaaatgttgaacaccgtcttgagtcactggtatttgatctgaaaagtggatgcaaagag
taa

DBGET integrated database retrieval system