KEGG   Methanosalsum zhilinae: Mzhil_0587Help
Entry
Mzhil_0587        CDS       T01541                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00020  Citrate cycle (TCA cycle)
mzh00620  Pyruvate metabolism
mzh00720  Carbon fixation pathways in prokaryotes
mzh01100  Metabolic pathways
mzh01120  Microbial metabolism in diverse environments
mzh01200  Carbon metabolism
mzh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mzh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mzhil_0587
   00620 Pyruvate metabolism
    Mzhil_0587
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mzhil_0587
Enzymes [BR:mzh01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     Mzhil_0587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK GARS_A ATPgrasp_Ter ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AEH60454
UniProt: F7XQF3
Position
633606..635099
Genome map
AA seq 497 aa AA seqDB search
MFNKVLVANRGEIAIRIMRACKELGVSTVAVYSDADSNALFTKYADEAYAIGPPPASRSY
LNIDAILEVAEKSGAEGIHPGYGFLSENSKFAEACEKAGINFIGPPSKVIEQMGSKIAAR
STMEKAGVPVVPGSGEPIEDIDVALEIADSIGYPVMVKASAGGGGIGMKVVKSRENFKAA
VSAIQSVARSTFGDPTVFVEKYLPEPRHIEFQILADKYGNTVYVSDRECSIQRRHQKLIE
EAPSPVMTPEFREEMGSAAVKAAKTIDYENAGTVEFLYSQGDFYFLEVNTRLQVEHTITE
LVTGIDLAKDQLHIACGEELPYKQEDININGWAIECRINAEDPLNDFAPSPGKIRRYRSA
GGPGVRVDSGVHVGYTISPYYDSMISKLSVWGRDRNEAISRMQRALYEYVVVGVTTNLPF
HRAVLSNDAFKKGELTTHFIEDNNILDEVRKIVDADSRASRTLASALDNYNPKVAAVAAA
VKSYMESTQALDQRKTK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacaaagtacttgttgcaaacagaggtgaaattgcaatccgaattatgcgtgcc
tgtaaagaacttggagtttctacagttgcagtatactctgatgctgacagcaacgctctt
tttacaaagtatgcagatgaagcctatgcgataggaccaccgcctgcaagcaggagttat
ctcaatattgacgcaatacttgaggttgctgaaaagagcggtgctgaaggaatacatcca
ggatatggctttctttcagagaactcaaagtttgcagaggcatgcgaaaaggcaggaatt
aatttcattggtccgccaagcaaggtaattgaacagatgggaagtaaaatcgctgcacgt
tcaaccatggaaaaagcaggagttcctgttgtgcccggcagtggagaacccattgaagat
attgatgtagctcttgagattgcagattcgataggatatcctgtaatggtcaaggcttct
gccggaggtggggggattggaatgaaggtagtaaagtccagagagaactttaaagctgcc
gttagtgcaatccagtccgttgccagatcaacatttggtgaccctactgtttttgttgaa
aaatatcttccagagccaagacacattgagttccagatactggcagataaatatggaaat
actgtttacgtatctgacagggaatgttcaatccagcgcagacatcagaagctcattgaa
gaggcaccctctcctgttatgactcctgaatttcgtgaagaaatgggcagtgcagctgta
aaggcagcaaaaacaatagattatgaaaatgccggaacagttgaattcctgtattcacag
ggtgatttctacttccttgaagtaaataccagactacaggtagagcatacaataacagaa
cttgttacaggaattgatctggcaaaagatcagctgcatattgcctgtggtgaagaactt
ccttacaaacaggaagatattaatataaacggatgggctattgaatgccgtataaatgct
gaggatccgctaaatgattttgcaccgtcacctggaaaaatacgcagatacaggtctgca
ggtggacccggtgtcagggttgacagtggggttcatgtaggatacactatatccccatat
tatgattcaatgatctcaaagctttctgtgtggggacgtgacagaaatgaagctataagc
cgaatgcagcgagcactttatgaatatgttgtggtgggtgttacaacaaatcttccattc
cacagagcagttctttcaaatgatgcattcaaaaaaggtgaactgacgactcactttatt
gaagataacaatattctggatgaggtcagaaaaatcgtggatgcagattccagagccagc
aggacactggcgtcagcactggataattataatccgaaggtagctgcggttgctgcggcg
gtaaaatcatatatggaatccactcaggcacttgatcaacgcaaaacaaaatga

DBGET integrated database retrieval system