KEGG   Methanosalsum zhilinae: Mzhil_1234Help
Entry
Mzhil_1234        CDS       T01541                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00010  Glycolysis / Gluconeogenesis
mzh00620  Pyruvate metabolism
mzh00640  Propanoate metabolism
mzh00680  Methane metabolism
mzh00720  Carbon fixation pathways in prokaryotes
mzh01100  Metabolic pathways
mzh01110  Biosynthesis of secondary metabolites
mzh01120  Microbial metabolism in diverse environments
mzh01130  Biosynthesis of antibiotics
mzh01200  Carbon metabolism
Module
mzh_M00357  Methanogenesis, acetate => methane
mzh_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mzhil_1234
   00620 Pyruvate metabolism
    Mzhil_1234
   00640 Propanoate metabolism
    Mzhil_1234
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mzhil_1234
   00680 Methane metabolism
    Mzhil_1234
Enzymes [BR:mzh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mzhil_1234
Lipid biosynthesis proteins [BR:mzh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mzhil_1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEH61088
UniProt: F7XMR4
Position
complement(1325833..1327779)
Genome map
AA seq 648 aa AA seqDB search
MEEAIESSLKEWQKIEPPEEFVKKANMNDPDIYDMAEKDYERFWEGIAENIDWYSKWKSV
LEWEPPHARWFIEGKLNASYNCLDRHIDSRGDKTAIIWEGEKGDIRKYTYRQLLDATSRF
ANSLKDMGVKKGDIVTIYLPMIPEAVIAMLACARIGAPHSVVFAGFSADALAQRIENSRS
KFLITCDGYLRRGKEIPHKKRADEGVSRVDTVDKVIVVRHTGSDVPMSKQRDVWWHEVMD
SASTGCDPEIMDSEDMLFLMYTSGTTGKPKGVVHTTGGYMVGTHITTNWVFDIKEDDIYW
CTADVGWITGHSYIVYGPLSNGATILIYEGAPDYPERDRFWDIVERHKVTIFYTAPTAIR
AFMRWGEDIPAKHDLSTLRLLGTVGEPINPRAWLWYYENIGNKRCPVVDTWWQTETGMIM
ITPLPGITPLKPGSATRPFPGIKAKVLDDEGNEVSQGHGGYLALTRPWPSMIRTVYKNEQ
RFIDTYWSKWDIDTYMSEDGARRDEDSYFWILGRVDDVIKVAGHRLGTMEIESTLVSHPE
VAEAAVVGKKDEVKGEVIVAYVTLAERISESDNLMSDLVDHVADEIGPIARPAHIFFTDE
LPKTRSGKIMRRILKSIADGEDVGDITTLQNPEIVEELKRKVDESGTN
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcgattgaatccagtttaaaagaatggcagaaaatagaacctccagaagaa
tttgtaaagaaggccaatatgaatgatcctgatatctacgacatggcggaaaaagattat
gaaaggttctgggaaggaattgctgagaacattgactggtacagtaaatggaaatctgtg
ctggaatgggaaccaccccatgccagatggtttattgaaggaaaactgaatgcttcctac
aactgccttgatcgccatatagattccagaggtgataaaactgctattatatgggaagga
gaaaaaggtgacatacgtaagtatacctataggcaacttctggatgcaacttcaaggttt
gccaattctctaaaagatatgggtgttaaaaagggtgatattgtaacaatatatcttcct
atgatccctgaagctgtcattgcgatgcttgcatgtgccagaattggagctccccatagt
gtggtgtttgcaggattctctgctgatgcacttgcccagagaattgaaaattcccgtagc
aagttccttattacctgtgatgggtatcttaggcggggaaaagagatcccacacaagaaa
agagccgatgaaggagtgagcagggtggatactgtcgataaagtcattgttgtcaggcat
accggcagtgatgtacccatgagtaaacagagggatgtctggtggcatgaagtgatggat
tctgccagtacaggctgtgatccagaaattatggattcagaagatatgctattcttgatg
tacacaagcggtacaactggcaagcctaaaggagtggttcataccactggcggatatatg
gttggtacgcacataactacaaactgggtttttgatatcaaagaagatgacatatactgg
tgtactgctgatgttggctggataacaggtcattcctacatagtatacggcccgttgtca
aacggggctacaattcttatctatgaaggtgctcccgattatccggaacgtgaccgcttc
tgggatattgtcgagcgtcataaggtgacaatattttatactgcacctactgctatcagg
gcatttatgaggtggggcgaggatatccctgcaaagcatgatctatctactcttcgatta
ctgggaaccgtaggggagccgataaacccgagagcatggctatggtattatgaaaatatt
ggcaataaaaggtgtcctgttgtagatacatggtggcagaccgaaaccgggatgataatg
atcactcctcttccaggcattacgccgttaaaacctggaagtgctaccagacctttcccc
ggtataaaggcaaaggtccttgatgatgagggtaatgaggtttctcaaggtcatggggga
tatcttgccctgacacgtccgtggcccagtatgataaggaccgtatataagaatgaacaa
agatttatagacacatactggagtaaatgggatatcgatacctatatgtctgaggatgga
gcacgccgggatgaggacagttatttctggatacttggacgtgttgatgatgttatcaaa
gttgcaggccatcggcttggaactatggaaatcgagagtactcttgtttcccatccagaa
gtggctgaagcggcagtggttggtaaaaaggatgaagttaaaggtgaagtcattgtagct
tatgtcacgctggcagaaagaatttcagaaagtgacaatcttatgagtgatcttgtggat
catgttgcagatgaaatcggaccaattgcacgtcctgcacatattttctttacagatgaa
cttccaaagacaagaagcggtaaaataatgcgtaggatattgaaatccattgctgatggt
gaagatgttggagatattactactctccagaatcctgagatagttgaagaactgaagaga
aaggttgatgaatcaggtaccaattga

DBGET integrated database retrieval system