KEGG   Methanosalsum zhilinae: Mzhil_1643Help
Entry
Mzhil_1643        CDS       T01541                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00520  Amino sugar and nucleotide sugar metabolism
mzh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mzh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mzhil_1643
Enzymes [BR:mzh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Mzhil_1643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind adh_short NAD_binding_10 UDPG_MGDP_dh_N KR NmrA
Motif
Other DBs
NCBI-ProteinID: AEH61479
UniProt: F7XPV8
Position
join(1758033..1758152,1758152..1758976)
Genome map
AA seq 314 aa AA seqDB search
MKKQILVTGGAGFIGSHLCEKLLQNGHEVICVDNFFTGKKRNITHLMDNHYFEVLRHDIN
DPISVEVDEIYNLACPASPIYYQRDPVQTTKTSVMGAINVLDLAKRLDVKILQASTSEVY
GDPELHPQPETYRGNVNPVGPRACYDEGKRCAETLFFDYKRQYDLDIKIIRIFNTYGPKM
HPKDGRVVSNFIVQALNDDDITIYGNGTQTRCFCYVDDLVDGIINMMNKPRDFNGPVNLG
NPEEYRILDLASKIMQLTNSNSELVYKPLPEDDPVKRKPDIDLAKKELGWEPKVSLEEGL
KKTISYFKELLPGK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaatacttgttacaggtggagcaggttttattggatcacacttatgtgaa
aagcttcttcaaaatggacatgaggttatttgtgtagataattttttcaccggaaaaaaa
agaaatattactcatttaatggataatcattattttgaagttcttcgtcatgatatcaat
gatccaatttcagtagaagttgatgaaatatataatcttgcatgtcctgcaagcccgatc
tattaccaaagagatcctgtgcagaccacaaaaacatctgtcatgggtgccattaatgta
ctggatctggcaaaaaggttagatgtgaaaatcttacaagcttctacttctgaagtttac
ggtgacccagagcttcatcctcaacctgaaacttatcggggaaatgtgaaccctgtagga
cccagagcctgctatgatgagggaaaaagatgtgctgaaactttattttttgactacaaa
cgtcaatatgatttagacattaagataataagaatatttaatacgtatggacctaaaatg
catccaaaagatggaagagtagtaagtaattttatagttcaggctcttaatgacgatgac
attacaatttacggaaacggaacacaaacacgatgcttttgttatgtggatgatttagtt
gatggaataattaatatgatgaataaacccagagactttaatggtcctgttaatcttggc
aatcctgaagaatacagaattttagatcttgccagcaaaataatgcaattgacaaattct
aacagtgaactggtctataaaccattacctgaagatgatcctgtgaaacgcaaacctgac
attgacctagctaaaaaggaattaggttgggaaccaaaagtatcattagaagaaggcctg
aagaagactatttcctattttaaagagttactaccgggtaagtga

DBGET integrated database retrieval system