KEGG   Methanosalsum zhilinae: Mzhil_1660Help
Entry
Mzhil_1660        CDS       T01541                                 

Definition
(GenBank) 3-isopropylmalate dehydratase, small subunit
  KO
K16793  methanogen homoaconitase small subunit [EC:4.2.1.114]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00300  Lysine biosynthesis
mzh00680  Methane metabolism
mzh01100  Metabolic pathways
mzh01120  Microbial metabolism in diverse environments
mzh01130  Biosynthesis of antibiotics
mzh01210  2-Oxocarboxylic acid metabolism
mzh01230  Biosynthesis of amino acids
Module
mzh_M00608  2-Oxocarboxylic acid chain extension, 2-oxoglutarate => 2-oxoadipate => 2-oxopimelate => 2-oxosuberate
Brite
KEGG Orthology (KO) [BR:mzh00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mzhil_1660
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mzhil_1660
Enzymes [BR:mzh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     Mzhil_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase_C Aconitase_2_N
Motif
Other DBs
NCBI-ProteinID: AEH61495
UniProt: F7XPX4
Position
1778764..1779246
Genome map
AA seq 160 aa AA seqDB search
MDIIRGRAWKYGNNIDTDVIIPGKYLRTTDMQVFADHAMEGIDPQFTEKISRGDLIVAGH
NFGCGSSREQAPLALKYAGISCVIAKSFGRIFFRNAINVGLPVVEADIECNEGDIIEVDL
EKGLIKTPEKTYQSNRLPDFLLEILKDGGLVAHRKKKAKK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggatataatcagaggacgtgcctggaaatacgggaacaatattgatacagatgtaatc
attccaggcaaatatctcagaaccactgacatgcaggtatttgcagatcatgcaatggaa
ggaattgatccgcagtttacagaaaagatcagcagaggcgacctgatagtggcaggacat
aactttggctgcggatcatcaagggaacaggcacccctggccctgaaatacgcagggatc
tcatgtgtgatagcaaaatcatttggaagaatattcttcagaaacgccataaacgtggga
ctgcctgtggtggaagctgatatagaatgcaatgaaggggatatcattgaggtggatctt
gaaaagggtctgataaaaacgcctgagaaaacctatcagtcaaacaggctccctgacttc
ctgctggagatcctcaaagacggtggtcttgtggcacacaggaaaaagaaggcaaaaaaa
tga

DBGET integrated database retrieval system