KEGG   Methanosalsum zhilinae: Mzhil_1733Help
Entry
Mzhil_1733        CDS       T01541                                 

Definition
(GenBank) F420-dependent oxidoreductase
  KO
K12234  coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00680  Methane metabolism
mzh01120  Microbial metabolism in diverse environments
Module
mzh_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mzhil_1733
Enzymes [BR:mzh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Mzhil_1733
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Mzhil_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_ligase
Motif
Other DBs
NCBI-ProteinID: AEH61568
UniProt: F7XQA6
Position
1850913..1851710
Genome map
AA seq 265 aa AA seqDB search
MAQVAVSKRGITLRIELFTVNDIPMIREGDDLAAIICNNTSLEDGDIVVIASTIVAKAEG
RIFSLENIVPGRRAIDIGHRCGRDPAFVQAVLDRSVECLVEAPFILVQLESGQICVNAGI
DDSNVEEGLFLDLPEDPDASARRIAADIKKMTGMRVSLVITDTNGRAFRIGQTGIAIGIA
NIEPVRDWIGESDLFGNRLQITQEAVADEVASAANLLMGEGSGGTPVVIMRGLNIHNTTG
SIQQIYRIEEEDIIKKGLKCLQKDS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggttgctgtcagtaaaagaggtatcacattgagaatcgagttgtttactgta
aatgacataccaatgatcagagaaggagatgaccttgctgctattatatgcaataatact
tcactggaagacggggatatagtagttattgcatccacaatagtagcaaaggctgaagga
agaatcttttcactggagaatatagttcctggcaggcgtgcaatagatattgggcacagg
tgtggcagagatcctgcatttgtacaggcagtacttgatagaagtgttgaatgtcttgtg
gaagctccttttatactggtccagcttgaaagtggacagatatgtgtaaatgcaggaatt
gacgattcaaatgttgaagagggattatttctggatcttcctgaagatcctgatgcaagt
gccaggcgtattgctgcagatatcaaaaaaatgaccggtatgagagtgtctcttgtgatc
acagatacaaatggaagagcattcaggatagggcagactggaatagccattggtattgca
aacattgaacctgtcagggactggataggagaaagcgaccttttcggaaacagacttcag
ataactcaggaagctgttgcagatgaggtcgcttctgctgcaaatctattgatgggagag
ggtagcggcggaactcctgtagtgataatgagaggattgaacatacacaatacgaccgga
tctatccagcaaatttaccgtatcgaagaggaagatattattaagaagggacttaagtgt
ctgcaaaaggattcctga

DBGET integrated database retrieval system