KEGG   Methanosalsum zhilinae: Mzhil_1897Help
Entry
Mzhil_1897        CDS       T01541                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mzh  Methanosalsum zhilinae
Brite
Enzymes [BR:mzh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mzhil_1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 GCD14 Methyltransf_3 Methyltr_RsmB-F Fibrillarin RrnaAD Ubie_methyltran Methyltransf_11 MTS Methyltransf_24 CMAS Methyltransf_23 Methyltransf_4 Methyltransf_12 Methyltransf_32 DUF938 Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AEH61732
UniProt: F7XKG1
Position
2005632..2006288
Genome map
AA seq 218 aa AA seqDB search
MEFEEKKKRMINGLKGQGISKKVLDAITKVDRHRFVPEQLEGDAYYDTPLPIGYNQTISA
PHMVAMMCDMLDLEEGHRVLEIGAGSGYNAAVMAELIGENGHIYTIERIKPLVDFAKNNL
EKAGYSNVTVVHGDGSEGYPSAAPYDRITVTSAAPEIPEIFLEQLKPEGILLIPVGIPYQ
ELYLVRKDLDGNIHKEPKGGVMFVPLVGKYGFRKDDGY
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgaagaaaagaagaaaagaatgatcaatggccttaaagggcagggaataagt
aaaaaggtacttgatgcaatcacaaaggtagacagacatcgatttgttccggagcagttg
gaaggtgatgcatattatgatacaccccttccgatagggtacaatcagacaatttctgcc
ccgcatatggtggccatgatgtgcgacatgctcgatcttgaggaaggacatagagtgctt
gaaatcggtgccgggtccggatataatgctgcagtgatggcagagctgataggagagaat
ggacatatatataccattgaacgcatcaaaccccttgtagattttgcaaagaataacctg
gaaaaagcgggctattcaaatgttacggtggttcatggtgacggatctgagggatatccc
tctgcggctccatatgaccgtataactgtcacttctgcagcaccagagataccagagatt
tttctggaacaattaaaacccgaaggcatactcctgattccggtgggcattccatatcag
gaattatatcttgttcgaaaggatttagatggcaatatacataaagagccaaagggagga
gtaatgtttgttccccttgtaggtaaatatggattcaggaaagatgatggttactga

DBGET integrated database retrieval system