KEGG   Methanosalsum zhilinae: Mzhil_2013Help
Entry
Mzhil_2013        CDS       T01541                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mzh  Methanosalsum zhilinae
Pathway
mzh00010  Glycolysis / Gluconeogenesis
mzh00020  Citrate cycle (TCA cycle)
mzh00620  Pyruvate metabolism
mzh00640  Propanoate metabolism
mzh00650  Butanoate metabolism
mzh00680  Methane metabolism
mzh00720  Carbon fixation pathways in prokaryotes
mzh01100  Metabolic pathways
mzh01120  Microbial metabolism in diverse environments
mzh01130  Biosynthesis of antibiotics
mzh01200  Carbon metabolism
Module
mzh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mzh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mzhil_2013
   00020 Citrate cycle (TCA cycle)
    Mzhil_2013
   00620 Pyruvate metabolism
    Mzhil_2013
   00640 Propanoate metabolism
    Mzhil_2013
   00650 Butanoate metabolism
    Mzhil_2013
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mzhil_2013
   00680 Methane metabolism
    Mzhil_2013
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mzhil_2013
Enzymes [BR:mzh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mzhil_2013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Imm52
Motif
Other DBs
NCBI-ProteinID: AEH61846
UniProt: F7XL34
Position
2124200..2124748
Genome map
AA seq 182 aa AA seqDB search
MKEIRIHGRGGQGSVTAAELLAVAAFADGKYSQAFPAFGVERRGAPVQAFTRLSDRPIRL
RSQVYQPDYVIVQDPTLIEVVDVANGIKDNGTIIINSEFEPEQFSFSTGAKVMTVDATRI
ALDVIGRPIVNTILLGAFAAATGEIQPGSIADAVKQRFSGKIGEKNAEAIDRAYNMTMEA
KA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagataagaattcatggtagaggtgggcagggttctgttactgccgccgagctc
ctggctgttgcagcatttgctgatggaaaatacagtcaggcatttccagcatttggtgtg
gagcgccggggtgctcctgtacaggcctttaccagactcagtgacagaccaatcagactg
agaagtcaggtataccagccagattacgtgatagttcaggatccaacccttattgaggta
gtagatgttgcaaacggtataaaggacaatggaacaattattatcaacagtgagtttgaa
cctgaacagttcagtttcagtacaggagcaaaagtaatgacagtggatgcaacaaggatt
gcactggatgttattggaagaccaattgtcaataccattctgctgggagcttttgccgct
gcaaccggagagattcagccaggatccattgcagatgcagtaaagcaaagattttccggt
aagatcggagaaaagaatgctgaagctattgacagagcatataacatgaccatggaggca
aaggcatga

DBGET integrated database retrieval system