KEGG   Neomicrococcus aestuarii: BHE16_01765Help
Entry
BHE16_01765       CDS       T04559                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
nae  Neomicrococcus aestuarii
Pathway
nae00030  Pentose phosphate pathway
nae00480  Glutathione metabolism
nae01100  Metabolic pathways
nae01110  Biosynthesis of secondary metabolites
nae01120  Microbial metabolism in diverse environments
nae01200  Carbon metabolism
Module
nae_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:nae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BHE16_01765
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BHE16_01765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nae04147]
    BHE16_01765
Enzymes [BR:nae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BHE16_01765
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BHE16_01765
Exosome [BR:nae04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BHE16_01765
  Exosomal proteins of colorectal cancer cells
   BHE16_01765
  Exosomal proteins of bladder cancer cells
   BHE16_01765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: APF41640
UniProt: A0A1L2ZR19
Position
complement(414451..415839)
Genome map
AA seq 462 aa AA seqDB search
MKTLLILGASGDLTQRLLLPGLASLLATGKVEHLNLKGVGSADVSAEEFSERVAKTFAPQ
LEDAHTTEAGRKVLSETQAASSYEVADVTAPGELGRLISSVPGPVAVFFALPPAISEKAL
VAATPEELPEGTTLVIEKPFGSSLESAKALNQKLTRLVPESRIHRVDHFLGKSTVLNILG
LRFANRLLEPLLSAEHVASVQLVYNEELALEGRAGYYDKAGALRDMIQSHLLQIMALLAI
DAPSTLGERDLRDKISEVLRATRLKNEPAIASRRARYTAGTSMGRAILGYAEEEGVDPAR
QTETLAEVDLNINNVRWNGVPFTLRSGKAMGEVRKEAIITFKPVSFLPDGFTGCDSPTML
RIGFGPDTLAIDLDVNGPGDPFHLDRITVGAELNKSGMLPYGEVLYGVLNGDPTLSVRAD
AAEECWRIVEPVLGAWEAGEVPLDEYPAGSFGPDAWASPHQN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atcaaaactctcttgattctaggagcctccggcgacctcacgcagcgactcctgctgccc
ggtctcgcgagccttctcgcaaccggaaaggttgagcatctcaacctcaagggcgtcggt
tcggcggacgtcagcgcggaagaattctctgagcgcgtagccaagaccttcgctccacaa
ctagaggacgcccacaccaccgaagccggacgcaaggttctgagcgagacccaagctgcg
tcgtcgtacgaagtagcggacgtcaccgcccccggagaattgggccggctcatctcctcc
gtccccggcccggtagccgtgttcttcgcgcttccgccagcgatctcggaaaaggcgctt
gtcgcggcgacccccgaggaacttcccgagggcaccaccttggtgattgagaaaccgttc
ggttccagcttggagtccgcgaaagcgctcaaccaaaagctcacccgtttggtgcccgaa
tcacggattcaccgcgtggatcacttccttggcaaatccaccgtgctcaacattttgggc
ttgcgctttgcgaatcgtctgttggaaccgttgctctccgcggagcacgtggccagcgtg
cagctcgtctacaacgaggagctcgccctcgagggccgcgccgggtactacgacaaagcc
ggggcgctgcgggacatgattcagtcccacttgctgcagatcatggctctgctggccatt
gacgcgccgagcacgctcggtgagcgggacttgcgagacaagatttctgaagtcctgcgt
gccacgcgcctcaagaatgagccagccatcgcgagccgccgcgcccggtacaccgccggt
acttctatgggacgcgccattcttgggtacgccgaggaagagggcgtggatcccgcgcgt
cagaccgagacgctcgccgaagtggatctgaacatcaacaacgtgcgctggaacggcgtt
ccgttcacccttcgatccggcaaagctatgggcgaagtgcgcaaggaagccatcatcacg
ttcaagccggtcagtttcttgccggacgggttcaccgggtgcgatagccccacaatgctg
cggatcgggtttgggccggacacccttgcgattgatctggatgtcaacggtcccggcgat
ccgttccaccttgaccgcatcacggtgggggccgagctcaacaaatccggcatgctcccc
tacggcgaagtcctttacggcgtactcaacggggatcctacgctctctgtgcgcgcggac
gccgccgaggagtgctggcggatcgtcgagcccgtgctgggcgcatgggaagccggcgag
gtccccttggatgagtacccggcgggttcctttgggccggacgcgtgggcgtcgccgcac
cagaattaa

DBGET integrated database retrieval system