KEGG   Neomicrococcus aestuarii: BHE16_11265Help
Entry
BHE16_11265       CDS       T04559                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
nae  Neomicrococcus aestuarii
Pathway
nae00670  One carbon pool by folate
nae00790  Folate biosynthesis
nae01100  Metabolic pathways
Module
nae_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nae00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BHE16_11265
   00670 One carbon pool by folate
    BHE16_11265
Enzymes [BR:nae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BHE16_11265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 RibD_C Phostensin
Motif
Other DBs
NCBI-ProteinID: APF41463
UniProt: A0A1L2ZPU0
Position
complement(2512621..2513133)
Genome map
AA seq 170 aa AA seqDB search
MIWAQSTNGVIGDAGSMPWHLPEDLQHFQRVTSGHPIIMGRRTWESLPPRFRPLKDRTSI
VLTSQEETSKEVTEKGGLVVSATADAMELARKQPGAEEIWVIGGGKLYEALLPLADTLVI
TRIDLELEGDTRAPELTDEWEQVMVDPAEDWKTSMSGLRYRSELWERKGA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgatctgggctcagtccaccaatggtgtgattggcgatgccggttccatgccttggcac
ctgcccgaagatctacagcacttccagcgagtcaccagcggacaccccatcatcatgggc
cgccgtacgtgggaatccttacctccacgtttccgtccgctcaaggaccgcacctcaatt
gtgctgacgtcccaagaggagacctcgaaggaagtcaccgagaagggcggcttggtggtt
tccgcgactgccgacgccatggagcttgcccgcaagcagccaggcgccgaggagatctgg
gtgattggtggtgggaagctttacgaagctctgcttcctctcgcggatactctggtgatc
acccgcatcgatctggagctcgagggtgacactcgtgcgcccgagctgaccgatgagtgg
gagcaggtcatggtggatccagcggaggattggaagacctccatgagtggactgcgctat
cgctctgaactgtgggaacgaaaaggagcttag

DBGET integrated database retrieval system