KEGG   Candidatus Nucleicultrix amoebiphila: GQ61_01830Help
Entry
GQ61_01830        CDS       T04833                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
naf  Candidatus Nucleicultrix amoebiphila
Pathway
naf00450  Selenocompound metabolism
naf00970  Aminoacyl-tRNA biosynthesis
naf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:naf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GQ61_01830
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GQ61_01830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:naf01007]
    GQ61_01830
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:naf03016]
    GQ61_01830
Enzymes [BR:naf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GQ61_01830
Amino acid related enzymes [BR:naf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GQ61_01830
Transfer RNA biogenesis [BR:naf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GQ61_01830
 Prokaryotic type
   Other AARSs
    GQ61_01830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ARN84283
UniProt: A0A1W6N391
Position
complement(389635..391161)
Genome map
AA seq 508 aa AA seqDB search
MSQKISYITTPIYYVNDIPHIGHAYTSLAADVLARFQRLNGVRVLFMTGTDEHGQKVEKS
AHAADLDPKEFVDRVSERFQDLHQKLNISNDLFMRTTDPKHILSAQEMWRRIEQNGHIYK
GSYQGWYAVRDEAYYAEKELIDGKAPTGADVEWVEEPCYFFRLSSWQENLLKFYKENPNF
IGPESRRNEVLRFVEDGLKDLSISRSTFKWGVPVPGDMDHVMYVWIEALSIYVTALGFPN
DQSETFKNFWPTSLHLMGKDIVRFHAVYWPAMLMAAGLTPPKRIFAHGWWTNEGQKISKS
LGNVIDPYKLMGEFGVDPVRYFLLREVPFGQDGDFSRTALIQRVNSDLANDLGNLVQRVL
SFINKNADARVPLKGDLTEADQALLTKMNQILEDCRKYAESQALNKMLEAIWEGVGEANR
YVDSEQPWSLRKTDITRMNTVLYVLAEVIRRLGLLTMPFMPTAAEKILDYVGADQQSRSL
VDWEKHILIPGAQLPKPEGVFPRIVEKE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaaaaatctcttatattacgactcccatttattatgtgaatgacattcctcat
attgggcatgcctatacgagtttggctgcggatgttctagcccgctttcaacgtcttaat
ggagtacgggtgttgtttatgacagggacagatgagcatggtcaaaaagttgaaaaatcg
gcccatgcagccgaccttgatcccaaagaatttgtggatagagtttctgaacgttttcag
gacttacatcaaaaacttaatatctctaatgatctttttatgcgcacaacagatcctaaa
catattttatctgctcaggaaatgtggcgtaggattgaacaaaatggtcatatctataaa
ggaagttatcaaggttggtatgcagttcgtgatgaagcctattatgcggaaaaagaactg
atcgatggcaaagcccccacaggtgcagatgtggaatgggttgaagaaccatgttatttt
tttagactttcgtcatggcaagagaatcttttaaaattttataaggagaatcccaatttt
attggtccggaaagtcgtcgcaatgaagtgttgagatttgttgaagacgggttaaaggat
ctttcaatctctcgatcaacattcaagtggggagtgcctgttcctggtgatatggatcat
gtgatgtatgtgtggatagaagctttgtctatttatgtgacagctcttggttttccgaat
gatcagagcgaaacgtttaagaatttttggccgacttcgttacacttaatgggaaaagat
atcgtccgatttcatgcagtttactggccggccatgttaatggccgctggtcttacgccc
cctaaacgtattttcgcccatggctggtggacgaatgaaggtcagaaaatctcaaaatct
cttggcaacgttattgatccttataagcttatgggagaatttggtgtagatcctgtgcgc
tattttcttttaagagaagttccttttggtcaggatggtgatttttcacgaactgcgctg
attcagcgagttaattctgatttagcaaacgatttgggaaatcttgtacaacgcgttctc
tcatttattaataaaaatgctgatgcaagggtacctttaaaaggcgatttgacagaggca
gaccaagccctgcttacaaaaatgaatcaaattctagaggattgtcgaaaatacgcagaa
tctcaggcacttaataagatgctcgaagcgatatgggaaggagtaggtgaagctaatcga
tacgttgatagcgagcaaccatggtctttgcgcaagactgatattactcgcatgaataca
gttctttatgttttggctgaagtgattcgtcgcttaggtttgttaacgatgccttttatg
ccaacagcagcagaaaaaattcttgattacgttggtgctgatcaacagtctagatcactc
gttgattgggagaaacatatcctcattcctggggctcaattaccaaaacctgagggagtt
tttcctaggattgttgaaaaagaataa

DBGET integrated database retrieval system