KEGG   Candidatus Nucleicultrix amoebiphila: GQ61_05420Help
Entry
GQ61_05420        CDS       T04833                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
naf  Candidatus Nucleicultrix amoebiphila
Pathway
naf00071  Fatty acid degradation
naf00072  Synthesis and degradation of ketone bodies
naf00280  Valine, leucine and isoleucine degradation
naf00310  Lysine degradation
naf00362  Benzoate degradation
naf00380  Tryptophan metabolism
naf00620  Pyruvate metabolism
naf00630  Glyoxylate and dicarboxylate metabolism
naf00640  Propanoate metabolism
naf00650  Butanoate metabolism
naf00900  Terpenoid backbone biosynthesis
naf01100  Metabolic pathways
naf01110  Biosynthesis of secondary metabolites
naf01120  Microbial metabolism in diverse environments
naf01130  Biosynthesis of antibiotics
naf01200  Carbon metabolism
naf01212  Fatty acid metabolism
naf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:naf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GQ61_05420
   00630 Glyoxylate and dicarboxylate metabolism
    GQ61_05420
   00640 Propanoate metabolism
    GQ61_05420
   00650 Butanoate metabolism
    GQ61_05420
  Lipid metabolism
   00071 Fatty acid degradation
    GQ61_05420
   00072 Synthesis and degradation of ketone bodies
    GQ61_05420
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GQ61_05420
   00310 Lysine degradation
    GQ61_05420
   00380 Tryptophan metabolism
    GQ61_05420
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GQ61_05420
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GQ61_05420
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GQ61_05420
Enzymes [BR:naf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GQ61_05420
Exosome [BR:naf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GQ61_05420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARN84821
UniProt: A0A1W6N4V4
Position
1091290..1092474
Genome map
AA seq 394 aa AA seqDB search
MQKDPIVIVAAKRTPAGAFQGQFKNVTTPHLGSAALKGAYESINLSPESIEEVYMGCVLP
AGLGQAPARQATLGAGLPPSTGATTVNKVCGSGMKAIISGYDALSLDHVKVVAAGGMESM
TNAPYLLAKARDGYRMGHDKIFDHMILDGLQDAYDHGQSMGVFAEKTAEKYNFSREQQDD
FAIESGKRALQAIEQKLFVDEIVPVVVKDRKDTITIDKDEPPLKLNFEKARTLKPAFKEG
GTVTAANSSSISDGAAAVIMMRKSEAEKRNLKPLAVIHAHAFHAKEPEWFTLAPVDAIKK
VLVKTGWTLNDVDLFEINEAFAVVAMAAMQDLKISHDKVNIHGGACALGHPIGASGARIL
VTLLYALKHRNLKKGVACLCIGGGEATALAIECL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagatcctattgttattgttgctgcaaaacgaacacccgctggcgcgtttcag
ggccagtttaaaaatgtcaccactccccatcttggttccgcagctcttaaaggcgcttat
gaaagcatcaacctttcgccagaatccattgaagaagtttatatgggatgcgttttgcca
gcaggtttgggacaagctcctgcacgtcaagcaacactcggtgctggcttacctccatcg
acaggcgctacaacagtgaataaagtatgtggttctggaatgaaagcgatcatctcaggg
tacgacgctttaagtctcgatcatgtaaaagtagtggccgccggtggcatggaaagtatg
accaacgctccttatcttttagccaaggcacgggatggctatcgtatgggacacgacaaa
atattcgatcacatgattcttgatggattgcaagacgcttatgatcatgggcagtctatg
ggagtgttcgcagaaaaaactgcggagaaatataatttttcaagagaacaacaagacgac
tttgccattgaatcaggcaaaagagccttacaagcgatcgaacaaaaattgtttgtcgat
gagattgttcctgttgtcgtgaaagatagaaaagatacgatcacgattgataaagatgag
cccccccttaaattaaattttgaaaaagcccgcactttaaaacccgcttttaaagaagga
gggactgtcactgctgcaaactcaagctctattagtgatggcgcagcggctgttatcatg
atgagaaaaagcgaagctgaaaaacgtaatttgaaacccttggctgtgattcacgcacac
gcatttcacgccaaagaacctgagtggttcacccttgcccctgttgacgcgattaaaaaa
gttctggttaaaaccggttggaccttaaatgacgtggatctgtttgaaattaacgaagct
tttgctgttgtcgctatggccgccatgcaagacttaaaaatctcccatgacaaagtcaat
attcacgggggagcttgtgcgttgggtcacccaatcggtgccagtggggcgcgcattctt
gtgacattgctttatgctctcaagcacaggaacttaaaaaagggcgtcgcctgcctttgt
attggaggcggcgaagcaacagcccttgcaattgagtgtctgtaa

DBGET integrated database retrieval system