KEGG   Candidatus Nucleicultrix amoebiphila: GQ61_07310Help
Entry
GQ61_07310        CDS       T04833                                 

Definition
(GenBank) hypothetical protein
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
naf  Candidatus Nucleicultrix amoebiphila
Pathway
naf00130  Ubiquinone and other terpenoid-quinone biosynthesis
naf01100  Metabolic pathways
naf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:naf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    GQ61_07310
Enzymes [BR:naf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     GQ61_07310
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     GQ61_07310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ARN85123
UniProt: A0A1W6N5J4
Position
1429591..1430349
Genome map
AA seq 252 aa AA seqDB search
MISLSKLLLTAYFFSLTIFSNLLASDLTTKEEEYLSRAKISMSHALPRQSSEDKDLAGLR
ILDVGSGGGGNAYEMMRRGAIVEVVEPIFEEIKFSVESGHVLPEYAHHAKIEDNFEECLR
SYANIHNIDMALHEESLQYRRSVKELGEEFNGRFDIVTIFMIAMNEGAAAERLAKLLKPK
GKLIIGYATAGEYVHSHADSRKALETFFSIDTVNELGVLSNPEDPLCCTTIRKGVDPWGT
NDVYVTFTKKED
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatttctttatcaaaattattgctgaccgcctactttttttctttaactattttttca
aatcttttggcttctgatttaacaacaaaggaagaagagtatctatctcgagctaagatt
agtatgagccatgcccttccaaggcaaagtagtgaggacaaagaccttgcaggactaagg
attttggatgtaggttctggtggtggtggcaatgcctatgaaatgatgcgtaggggagca
atcgttgaggtagttgaacccatcttcgaggaaataaagttttctgtggaaagcggtcat
gtcctgccagaatatgcccatcatgctaaaattgaagataattttgaagaatgtttacgt
tcctatgctaacatacataacattgatatggctttgcatgaagaatctcttcaatatagg
cgttcagtgaaagaacttggagaagaatttaacggtcgttttgatatagtgaccattttt
atgattgcaatgaatgagggagctgcagcagaaaggttagcaaaacttctgaaaccaaaa
ggtaaacttattattggctatgctacagctggtgaatatgtacactcacatgcagactct
cgtaaagctcttgaaacgttcttctcaattgataccgttaatgagttaggagttttatct
aacccagaagatccgttgtgctgcacgacgataagaaaaggagtagatccttggggcact
aatgatgtctacgtgacttttacaaaaaaagaggattag

DBGET integrated database retrieval system