KEGG   Candidatus Nucleicultrix amoebiphila: GQ61_07670Help
Entry
GQ61_07670        CDS       T04833                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
naf  Candidatus Nucleicultrix amoebiphila
Pathway
naf00564  Glycerophospholipid metabolism
naf01100  Metabolic pathways
naf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:naf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GQ61_07670
Enzymes [BR:naf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     GQ61_07670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ARN85181
UniProt: A0A1W6N5S9
Position
1503101..1503787
Genome map
AA seq 228 aa AA seqDB search
MKQYLVPNIHRDGWVFIAIFAMVTFIIGLESDALAWIGAILTGWCVYFFRDPDRVTPVRT
GLVVSPADGLIQSITEAPPPQEMGLKKGKYTRISIFLSVFDVHVNRVPIGGKIIKSIYHP
GKFFNASLDKASIHNERQSLVVLTEDKQEIGFVQIAGLIARRIRCDVEEDQKVKTGQRFG
MIRFGSRMDVYLPKETPILVLEGQRAVGGETILADFKADAGIKSGEKH
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtatctggtccccaatattcatagggacggctgggtctttatcgctattttt
gctatggtgacttttattattggacttgaatctgatgctttggcgtggataggtgctatt
ctaacggggtggtgtgtttacttttttagagatcctgaccgtgtaacgccggtgagaacg
ggtttggttgtcagtcctgcggatggattgatccaatccattactgaagctcctcctcct
caggagatgggcttaaaaaaaggaaaatacacgcgtataagcatttttttgagtgttttt
gatgttcatgtgaatcgtgtgccgattggagggaaaataataaaaagtatttatcatcct
ggtaaattttttaatgcttcccttgataaggcgagtattcataacgaacgtcaatctctc
gtggttctcacagaggataagcaagagatcggatttgtacagattgcaggattaattgca
cgtcgcattcgttgtgatgtggaagaagatcaaaaagtaaaaacgggtcaacgttttggt
atgattcgctttggcagtcgtatggacgtttatttacctaaagagacaccaattttagtt
cttgaaggacaaagagccgttggaggagaaaccatccttgctgattttaaagcggatgca
ggaattaaatcaggcgagaaacactga

DBGET integrated database retrieval system