KEGG   Nocardia arthritidis: F5544_18740
Entry
F5544_18740       CDS       T06735                                 

Definition
(GenBank) TIM barrel protein
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
nah  Nocardia arthritidis
Pathway
nah00525  Acarbose and validamycin biosynthesis
nah01100  Metabolic pathways
nah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nah00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    F5544_18740
Enzymes [BR:nah01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     F5544_18740
SSDB
Motif
Pfam: AP_endonuc_2 PdxJ WEMBL
Other DBs
NCBI-ProteinID: QIS11619
UniProt: A0A6G9YEG3
Position
complement(4204093..4204875)
AA seq 260 aa
MTALALPQWRLDTDRGIAILRALRHGIARVHLDFGGAHRGPRLDDPRTLRETARAMAGVE
VPVLAVNHVNDVGMFGGSGDFAPHCLRLVERAIQVAAELGIPTVHIPNFRASAVTDAAKL
RIAAEFLAAAATYARRFGIGVASESGLGAADLALLYRLTGARELTIVVDTGNLVDAGHAI
PEMFALAETVCLHSDIHVKAPTAPGAPPLSELIAHQLLPHHRPVAVLLENDYRASESALI
RDIAWARAAFRARSGGSAAS
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaccgcgctggcgctgccgcagtggcggctcgacaccgaccgcggtatcgccatcctg
cgcgccctgcggcacggcatcgcccgcgtacacctcgatttcggtggtgcgcatcgcggc
ccgcgcttggacgatccacggacgctgcgggagacggcgcgggccatggccggtgtcgag
gtcccggtgctcgcggtgaatcatgtcaacgatgtcggaatgttcggcggctccggtgat
ttcgccccacactgcctccggctggtcgagagggcgattcaggtcgcagccgagctcggc
atccctaccgtgcatatacccaatttccgggcgagtgccgtcaccgacgccgcgaagctg
cggatcgcggccgaattcctcgcggcggccgcgacgtatgcgcggcggttcggcatcggc
gtcgcctccgaatccggcctcggcgcagccgatctggcgctgctgtatcggctgaccggc
gcacgggagctgaccatcgtggtggataccggcaatctcgtcgacgccggacatgccatc
cccgagatgttcgcactcgccgaaacggtgtgcctgcactccgacatccacgtgaaggcg
ccgaccgcgccgggcgcaccaccgctgagcgaattgatcgcccaccaactcctccctcat
caccggcccgtcgccgtgcttctcgaaaacgactaccgcgcaagcgaatccgccctcatc
agggatatcgcctgggcccgcgcggcattccgcgcccgatccggagggagcgccgcctca
tga

DBGET integrated database retrieval system