KEGG   Necator americanus: NECAME_01037Help
Entry
NECAME_01037      CDS       T04867                                 

Definition
(RefSeq) proline--tRNA ligase
  KO
K14163  bifunctional glutamyl/prolyl-tRNA synthetase [EC:6.1.1.17 6.1.1.15]
Organism
nai  Necator americanus
Pathway
nai00860  Porphyrin and chlorophyll metabolism
nai00970  Aminoacyl-tRNA biosynthesis
nai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NECAME_01037
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NECAME_01037
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nai01007]
    NECAME_01037
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nai03016]
    NECAME_01037
Enzymes [BR:nai01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     NECAME_01037
    6.1.1.17  glutamate---tRNA ligase
     NECAME_01037
Amino acid related enzymes [BR:nai01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   NECAME_01037
Transfer RNA biogenesis [BR:nai03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NECAME_01037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome HGTP_anticodon tRNA-synt_2b Proteasome_A_N WHEP-TRS TPR_17 TPR_14 TPR_11 TPR_1 TPR_2 TPR_19 TPR_8 TPR_16
Motif
Other DBs
NCBI-GeneID: 25341081
NCBI-ProteinID: XP_013292316
UniProt: W2SK93
Position
Unknown
AA seq 1940 aa AA seqDB search
MAELKAALKQAKKLLGEGQSEDALNTLQRMLSKLGLCMRRCDQLLTPFFISEAVTLFFKA
INLDPKLPAAWQGLYKLFESGKLPADDRALEVCNRLITLSDSEEKRQVIEESRRRFFFEL
CRYDQLEKDLGTNMTLLRKVIDRLTRKDILSATETTLLAKAFKDVKGSFNENAEWHLQYC
KFIYKRHDQEWIEEVKKFCSRHSYEGIAWIRSRLLEILAEEFFHTLIIPDAIFELYLKCT
SNINEVEKKTDQILRSLSGDDMASTLDIIDGLSDASLTYLPLAMIAVQLLAEVENWEKVV
QVVDWILTQKVTDISENVACWLKKRALLEMNNAEEALGVKVSPDRPPSMFVIDSAKLTLL
KEDELDELIQECDVDSADARRMRIVKALQSGADDMSVMDAESLLCDDSVSWRDLVLIAEL
NIALGKDATSLLVKAAKMNPRSSRVFFVLGKSLRSKNPTKARLCLERAVKIRPTNEEYVR
ELDDLYYDAGESAEYRLKLLGQLNVYRKPMWLRKRLVELAKIKQDWDTVIDEVQQIIRHH
QEDVTSWALLAEAYSHRGNLQSSVNAYGRVLEIHPESDYAICLIQVLMRMHNLEGAAEQC
ERWRSLEIENLQLKNVVDLLDAQVHLRLFYKTQDEERFEHLKVVFKLVESVVSERPRISL
AYKLAGDALLLVIKYRDEIMKNVGIPASWSISDRLSAVRSAVMFYAAALDINRENVWAWS
DLAVALLHQARLDNSVEHAVKASDCLRKAMSLCNSAETRSQVWTLLAEAARLSATATEDA
SHSTALQQHYLVRALQLNKANDEAWLRLALLYYTNGAVCEAICFVFLIYLDGNDVQMDLA
HLAIEEALKHNPQLAEAWCAYAMKADSEGAYHEAVDMFRHSVSIKPIAEAVMKYTAMLCQ
TLRTKMFDPATVMIDFSKVLRLKDENDSVEKNKLLHIGILAELFGYYKDAVDCICASGEG
GVHLQRARLKAGEDVRYPEKPLEKLAKLCAMKTENLFGLLKEKQPLYRDVFDRIAATEAE
GLQELYRKYSKSISVPLVVAAVIRFCIPLCDQAVSVLHEVLPRHELIDVFPTIMPEEMDN
GLIYVEQDGEEPFRYSHFVAKDLTFHLFKNYFRLFSSCRMANELEIEKEIVQQGDLVRKL
KGDASATEEMKKEAIDKLLRLKLTYKEITGKEYATPGARQQKEKKPAAEKKKAEPKADGK
KQTKLGIEISKEENYSDWYSQVITKAEMIEYYDVSGCYVLRPWSYAIWEGIQTWFDSGIK
KLGVKNCYFPMFVSNAALEREKTHIADFAPEVAWVTRAGSSEMAEPIAIRPTSETVMYPS
YKKWVQSHRDLPIKLNQWCNVVRWEFKHPTPFLRTREFLWQEGHTAYATPEEAVKEVFQI
LDLYAGVYTDLLAIPVVKGRKSEKEKFAGGDFTTTVEAYVPCNGRGIQGATSHHLGQNFS
KMFDISFEDPVSGGKAYAWQNSWGLSTRTIGAMVMIHADNNGLVLPPRVAAIQAIILPVG
ITAQTTDEQRKHLMDTADELAKILVDADVRAEADLRENYSPGWKFNHWELKGVPIRIEIG
PKDLASDQVTAVLRYSGQKLAVKRAELVNEIKRLLEMTHVEMYNKSVLISKSSNNSLMTN
SSFFLPFAHLGMSLNFISLDPEFCGFCGAILPMPQTAPSSVACLVCGTRWHVKETMSRGS
SAGFDRHITIFSPEGRVYQVEYAFKAINSTNLTAVAVKGNQTAVIAVQKRVPDSLIVADS
VTSIYQLSPTVGCCAIGMIPDCKFQVRRAQMEAAQWKYQNGYDMPCELLAKRMADKNQYY
TQNAEMRSLGCAMIMISFDDEDGAVVFKVDPAGYYRGMKAVSVGVKQVTASSFLEKKIKK
KSDLNHDETIQLAIEALQSSLGIETRSKDLEVVVVSKKEKSFTLVQEQKFVQLSALIAFF
CRKLTNDQVEHHLNAIANRD
NT seq 5823 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgaaggcggccctgaaacaggctaagaagctgctgggagaaggccaaagt
gaagatgctcttaacacactacaaaggatgttaagcaagctagggctttgtatgagaagg
tgtgaccagctgcttactccctttttcatttctgaagcagtgactctgttttttaaggcc
attaatttggatccgaagctcccggcagcgtggcagggattgtacaaacttttcgagtct
ggcaagctacctgcggatgaccgtgcgttagaagtatgtaatcggcttataaccttgagt
gattctgaagaaaagcgccaagtgatagaagaatcccgcaggaggttctttttcgagctt
tgtcgatatgatcaactggagaaagatcttggaacgaacatgactcttttgaggaaagtt
attgacagactaacaaggaaagatattttgtctgcgactgaaactacattacttgctaaa
gccttcaaagacgttaaagggtcatttaatgaaaatgctgaatggcacttacagtactgc
aagttcatttacaagaggcatgatcaagagtggatcgaggaagtgaaaaagttctgcagt
cgccattcgtatgaagggatcgcctggatacgcagtcgtcttttggaaattttagctgaa
gaattctttcatactttgataattccggacgcaatcttcgagctttacttgaagtgcacg
tcaaatataaatgaagtcgagaagaaaactgatcaaatacttagatcactgagcggtgat
gatatggcatccactctggatattattgatggattatcagatgcttcgctcacatatctg
cctcttgctatgattgccgtccagttactagctgaagtcgagaactgggaaaaagttgtg
caggtagtcgattggattctcacgcaaaaagtgacagatatcagcgaaaatgttgcatgt
tggcttaagaaacgagctcttctggaaatgaacaatgcagaggaagcattaggagtcaag
gtctcaccggatcgtcctccatcgatgtttgtgattgatagcgcaaaactgactctattg
aaagaagatgagttggacgaactcattcaggaatgcgacgtggactcagctgatgcaagg
cgaatgaggattgtaaaagcgctacaaagtggagcagatgatatgtcagtgatggatgct
gagtcgcttctttgcgatgactcggtgtcttggcgggatttggttcttatagcagagctt
aatattgcactgggaaaagacgccacctccttgttagttaaggcagcaaaaatgaatcca
cgttcaagccgtgtcttctttgttctcggtaaatcgttgcggagcaaaaacccgacgaaa
gctaggctttgcctcgaaagggcggtgaaaattcgacctaccaacgaggaatacgtccga
gaattggacgacttgtactacgatgcaggagaatcagctgaatatcgtctaaaattgttg
ggtcaactaaacgtgtacaggaaaccgatgtggttgaggaaaagattggtagaacttgcg
aaaatcaaacaagactgggacactgtgatcgatgaggttcagcagattatcagacatcat
caggaagatgtcacaagttgggcgcttttggctgaggcttactcgcatcgaggaaatctg
cagtcatctgttaatgcgtatggtagagtgctagagattcatccagaaagtgactatgcg
atctgtctcatacaagtattgatgaggatgcacaaccttgaaggtgcagctgagcagtgt
gaacgatggcgatcgctagaaatagagaatctgcagttgaaaaatgtggtagacttgctg
gatgcgcaggtgcacctacgtttgttctacaagacgcaggacgaagaacgttttgaacat
ttgaaagtggttttcaaactcgtggaaagtgttgtatcagaacgacctcgtatatctctc
gcttacaaattagcaggagatgcacttttgctggtaatcaagtatcgcgacgagattatg
aagaacgtgggaatacctgcgagttggtcgatttctgatcgtctatcagctgtgcgatca
gcggtgatgttctacgcggctgcgctggatatcaatcgcgaaaatgtgtgggcgtggagt
gatttggccgttgctttactccatcaggctcgtctcgataactctgtggagcacgcggtg
aaagcatcagattgtcttcggaaggccatgagtttgtgtaacagcgctgaaacgcgttca
caagtctggacacttctcgctgaagcagcgcgattgtccgcaactgcgacagaggatgct
tcgcactcaacggctcttcagcaacactatcttgttcgtgccttgcaactgaacaaagct
aacgatgaggcttggctacgtctggcacttctctactacacaaatggagcggtatgtgag
gcgatatgttttgtttttcttatatacttagacggtaacgacgttcagatggatctagct
catcttgctatcgaagaagccctcaaacacaatccgcagcttgcagaagcatggtgtgcg
tacgcgatgaaagcggattcagaaggagcttaccacgaagcggttgatatgttccgtcat
tctgtatcgataaaaccaatagctgaagctgttatgaaatatacggcaatgttgtgtcaa
acacttcgtacgaaaatgttcgatccggctactgtgatgatcgatttcagcaaggtgctg
agactaaaggatgaaaacgacagtgttgagaagaataaactattacatattggcatccta
gcagagttatttggatactataaggatgcagttgactgtatctgtgcgagcggagaaggc
ggagtccatttacaaagggctcgcttgaaggcaggcgaagatgttcgttaccccgaaaaa
ccgcttgaaaagcttgcaaaactatgcgcaatgaagacagagaacttgttcggtcttctc
aaagagaaacaaccactctatagagacgtttttgataggatagcagctacagaagccgaa
ggcctgcaagagctttacagaaaatactcgaaatctatttctgttcctctggtggtggca
gctgtgattcgattttgcatacctctgtgtgatcaagcagttagcgtacttcacgaagtt
ttaccacgacacgagctgatagatgttttcccaacgattatgccagaagaaatggacaac
gggctaatatatgtagaacaggacggcgaagagccattccgatatagtcacttcgttgcg
aaagatctgacctttcacttattcaaaaattacttcaggttatttagtagctgtagaatg
gctaacgaactggaaattgagaaggaaattgtacagcaaggcgatcttgttcggaaactg
aaaggagatgcttctgctacagaggagatgaaaaaagaggctatagacaaacttctacga
ctgaagctaacctacaaggagataactggcaaagagtatgcgacacccggtgctcgccaa
caaaaagagaaaaaacccgctgcggaaaagaagaaggcagaacctaaggcggatggaaag
aaacagactaagctagggattgagatttcgaaggaagagaattactcggattggtacagt
caggtgatcacgaaagccgaaatgattgaatactacgacgtgtcaggatgctatgttttg
cgtccatggtcatatgcaatttgggagggaattcagacatggttcgacagcggcataaag
aaattaggagtgaagaattgttacttccccatgtttgttagcaatgctgcattggaaaga
gagaaaacacacattgctgattttgcacctgaggtggcctgggtaacccgtgctggttcg
tctgagatggccgaacccattgcgattcgtccaacttccgagaccgtcatgtatccatcg
tacaaaaaatgggtgcagtcccacagggatcttccaatcaagttgaaccaatggtgcaat
gttgttagatgggagtttaagcatccaacaccttttctccgtactcgtgaattcctttgg
caagaagggcataccgcttacgccactcccgaagaagccgtaaaagaagtgttccaaatt
cttgatctctacgccggtgtttacacggatctcctagcaattccagtagttaagggtaga
aagagtgaaaaggaaaaatttgctggtggagattttacaactacagtagaagcatacgta
ccatgtaatggacgaggtatacagggagccacttcccatcatttgggtcagaatttctcg
aaaatgttcgacatctcgtttgaggatccagttagtgggggcaaggcatatgcttggcag
aactcatggggtttgtcaactcgaaccataggtgcgatggtaatgatccatgctgacaac
aatggacttgttcttccacctagggtggcagctatccaggctattattcttcctgttggt
ataacggcccaaactactgatgaacagcgcaaacatctcatggacacagccgatgaacta
gcaaagatcctcgttgacgctgacgtccgagcagaagctgatttgagggaaaactattca
cctggctggaaattcaaccactgggagttgaaaggagtgccaattcgaattgagattgga
ccaaaggacttggcttccgatcaagtcactgctgttttacggtatagcggccaaaaattg
gctgtaaagagagcagagctcgtgaatgaaatcaagcggttgctagagatgactcacgtc
gaaatgtataacaagtctgttttgatttcgaagagttcaaacaactccttgatgacaaat
tcatccttctttctcccttttgcgcatctaggaatgtcccttaatttcatctcattggat
ccagaattttgtggattttgtggggcaattcttccaatgcctcaaactgctccatcctca
gttgcttgtcttgtttgtggtactcggtggcacgtgaaagaaacaatgtctcgtggaagc
agtgctggttttgatcgtcacattacaattttttcacctgagggaagggtttatcaggtg
gaatatgcgtttaaagctattaactctaccaatctgacggctgttgctgtgaagggcaac
caaacagcggtgatcgctgtacaaaagcgtgttcccgacagcttgatagtggccgactca
gtgacgtccatctatcagctgtcgccaacagttggatgttgtgctataggaatgatcccc
gactgcaaattccaggtccgccgagcccaaatggaagctgcacaatggaagtaccagaat
ggctatgatatgccatgtgaacttttagcaaagagaatggctgacaagaatcagtactac
acacaaaatgccgagatgaggagcttgggatgtgccatgattatgatctcgtttgatgac
gaggatggagcagtagtgttcaaagttgatccagctgggtattatcgcggcatgaaagca
gtgtctgtaggggttaagcaggttactgcatcttcattccttgagaagaaaatcaagaaa
aaatctgatctaaatcacgatgaaaccatccaactggccattgaagctcttcaaagtagt
ctcggtatcgaaacccgctccaaggaccttgaagtagtcgtggtttcgaagaaggagaaa
agtttcacgttggttcaagaacagaaatttgttcagttaagtgcgctgattgcttttttt
tgtaggaaactgacaaatgatcaagttgagcaccatctaaatgcaattgcaaaccgagat
tga

DBGET integrated database retrieval system