KEGG   Necator americanus: NECAME_01109Help
Entry
NECAME_01109      CDS       T04867                                 

Definition
(RefSeq) HAD superfamily hydrolase, 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
nai  Necator americanus
Pathway
nai00230  Purine metabolism
nai00240  Pyrimidine metabolism
nai00760  Nicotinate and nicotinamide metabolism
nai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NECAME_01109
   00240 Pyrimidine metabolism
    NECAME_01109
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NECAME_01109
Enzymes [BR:nai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     NECAME_01109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 25341153
NCBI-ProteinID: XP_013291226
UniProt: W2SH79
Position
Unknown
AA seq 539 aa AA seqDB search
MSLRVFVNRSLRMEKINFFGFDMDYTLVQYRSPDLEILAFELAIERLIDMGYPEEIRKFK
YDPIFPVRGLWFDYAYGNLLKVDGFGNILVGMHGFKFLKTSEIEEIYPNKYLQLSESRVF
VLNTLFNLPETHLLAYLIDYFDSHTDYTLLDDKTGLLGGDVLVSYKSIFHDCRSAVDWVH
LESDMKEMIMGNMEKYVVQDDRACLLLRQLREAGRQTFLLTNSDYRYTDKMMSFLLGDDW
RSYFNICVVDAKKPKWFAEGTVFREVDTNTGAVKLGIHTGPLKEGVVYSGGSSDAFHKIV
KARGKDVLYIGDHIFGDVLRSKKSRGWRTFLVIPELDHELTVWTDRRPLFEQLNQLDNTL
ADIYKHLDATSRNKPQIHTVLQKVKSLAHEMDQEYGVLGSLFRAGSRTTFFASQVERYAD
LYASSCYNLVHYPSFYFFRAAMQLMPHESTVDHSSVLKSSKTDLLKRQESVGQQVRGWTK
KTANENEFCHEEEEDEQSISDGEPGPRLRSKSLSDDAAEEEVADTDVVGVPPAFVDQQQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttagggtgttcgtcaatcgatctcttcgaatggagaagatcaacttcttcggt
ttcgacatggactacacgcttgtccaatatagatctcctgaccttgaaatcctagccttt
gaactagctattgagcgactcatcgacatgggatatccagaagaaattcggaaattcaaa
tacgatccgattttccccgttcgaggattgtggttcgactacgcatatggtaatcttctg
aaagttgatggttttggaaatattcttgtcgggatgcatggttttaaattcctgaagacg
tctgaaatcgaggaaatatatccgaacaaatatcttcaattgtccgaatcacgtgtattt
gtgctgaatacgttgttcaatcttcccgaaacgcatctgctcgcctatctcatcgactat
ttcgacagccacaccgactacaccctgttggacgataaaaccgggctgctgggtggtgat
gttcttgtatcctataaatccatattccatgattgtcgaagtgctgttgactgggttcat
ctcgagagtgacatgaaggagatgatcatgggaaatatggagaaatacgtggtgcaagac
gacagagcatgtttgctactacgacaactacgtgaagccggccgtcagaccttcttactc
actaatagtgactacagatacacggataaaatgatgtcattcctccttggtgatgactgg
cgatcttatttcaacatctgtgttgtagacgcgaagaaaccaaaatggttcgctgaggga
acagttttccgtgaggtggacacgaatacgggtgctgttaaattaggaatccatacagga
ccgctaaaagaaggcgttgtttattcaggaggttcaagcgatgcgtttcataaaattgta
aaagcacgaggaaaggacgtgctatatattggtgaccatatttttggtgatgttttaagg
tcaaagaaatccaggggctggaggaccttcctcgttattcctgagctggatcatgaactt
acagtatggacagatcgacgaccgttatttgaacagctcaaccaacttgataatactcta
gctgatatctacaagcatttagatgctacttctaggaataagccacaaatccataccgtt
ctacagaaagtgaagagcctcgctcacgaaatggaccaagaatatggagttttaggatct
ctatttcgtgctggttctaggactacattcttcgcctctcaggtggagaggtatgccgat
ctctatgcatcatcctgctataatctagtacattatccgtcattttacttcttccgagct
gcaatgcagctgatgcctcacgaaagtaccgtggaccattcctctgtgctgaagagttcc
aagacagacctattaaagagacaagagagtgttggacaacaagttcgcggatggacaaag
aaaacagcaaacgagaatgaattttgtcatgaagaagaggaagacgaacaatctatcagc
gatggtgaacctggtccacgtcttcgctcaaaatcactcagcgatgatgcagctgaggaa
gaagttgccgatacggatgttgtcggagtgccgccggcatttgttgatcagcaacaataa

DBGET integrated database retrieval system