KEGG   Necator americanus: NECAME_02280Help
Entry
NECAME_02280      CDS       T04867                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
nai  Necator americanus
Brite
KEGG Orthology (KO) [BR:nai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nai01002]
    NECAME_02280
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nai04147]
    NECAME_02280
Enzymes [BR:nai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     NECAME_02280
Peptidases [BR:nai01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   NECAME_02280
Exosome [BR:nai04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   NECAME_02280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 DLH DUF818 Abhydrolase_2 COesterase Abhydrolase_5 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 25342320
NCBI-ProteinID: XP_013303108
UniProt: W2TI88
Position
Unknown
AA seq 272 aa AA seqDB search
MLPRSVSADYREKGIHPSDDEMEKLLSSEKYPIILYLHGNSFDRTIGHRVELYNVLNKLN
CQVVAFDYRGYGDSDGNPSEGGLVNDSRLVYDYVRRHSANNTLIVWGHSMGTGFPLRWMS
EEMVQKYIMSPLRRVGLDMNSDKRIANITCPILILHAENDHVIPVRLGRKLKDAAVAASR
DVKYVEFEEARNYKHKFIYLAPELSSLIPSVISSVGQSDLTSVIHMDDLCSLVTGLSKSS
LILIIQRIYRLYKAGKESEEFLIYIASSISHR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgaggtctgtgtctgctgattaccgtgagaaaggcattcatccctcagatgat
gagatggagaagttgttgtcatcagagaagtatccgatcatactataccttcatgggaac
tcttttgataggacaattggacatcgagttgagttgtacaacgtactcaacaagctcaac
tgtcaggtggtggcgtttgactatcgaggatatggtgattcggatggtaatccttccgag
ggaggtttagtcaatgatagtcgcctcgtttacgattatgttagacgtcatagtgccaac
aacacactcattgtctggggtcattctatgggaactgggtttccattgcgatggatgtct
gaagagatggtgcagaagtacatcatgagtcctttgagaagggttggtctcgacatgaat
tcggacaaacgaattgctaacataacatgcccaattctcatactccatgctgagaatgac
cacgttattccagttagactgggccgcaaactgaaggatgctgctgtagctgcctcacga
gatgttaaatatgtagaatttgaggaagcgaggaactataagcacaagtttatctatttg
gctcctgagctatcgtcacttattccatctgttatctcctctgttgggcagtctgacctt
acttctgtcatccacatggatgatctctgcagtttggtaactggtttgtctaagagctct
ttaatattgatcattcagagaatttatcgcttatacaaagcgggcaaagaatccgaagag
ttcctgatctacatcgctagtagtatttctcatcgctaa

DBGET integrated database retrieval system