KEGG   Necator americanus: NECAME_03124Help
Entry
NECAME_03124      CDS       T04867                                 

Definition
(RefSeq) hypothetical protein
  KO
K03254  translation initiation factor 3 subunit A
Organism
nai  Necator americanus
Pathway
nai03013  RNA transport
Brite
KEGG Orthology (KO) [BR:nai00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    NECAME_03124
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nai03012]
    NECAME_03124
Translation factors [BR:nai03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    NECAME_03124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI Ribosomal_S10
Motif
Other DBs
NCBI-GeneID: 25343162
NCBI-ProteinID: XP_013299933
UniProt: W2T927
Position
Unknown
AA seq 999 aa AA seqDB search
MPPNSFQKPETALKRAQELIQARRYKQWTQTHELIMMKHVELCVLLKKPHVAKDALFQYK
TLTHQVAVKSLETVIEHFLQMAEQKTEEAQKTSIEKVEEIDDLDQGDVPETLLLSVVSGA
AAQDRELDFSVGYHCALLRVKLSSPESLTMMQETRLCQLDTAIQMELWQEAYRSAEDVHG
MMQLSKDKDKRMVKPASYVSYYDKLALVFWKAGNSLFHAAALLQKFIIYKDMKKSFTAEE
AQEQASRVLLATLSIPDGADAPSDLTRHLDIEDQHLTNIRLLSNLLRLPIAPTRAGLLKE
AARLGVPEMASDSTNALYKLLENNFAPLRLAQEVEAQLVKIDRPDHLQYVDALKEVVATK
ALKQISVIYDSISWNRVQKIIPFYSEMELERLVVDVSKHRFVKAQIDHRSGCIRFGAADV
TLAGGVDLEEADGFTGDDAQLGVEGIRTHLELMYNKLRSTVELLDGDKRTEALIARVKHH
AINYERTKNSKQETDRILERRRKIEYYKETSERVKAERSQQAAAELAKREEAKRAEEMKR
LEQENIESERKRRLAEQEEVQRKIKQDQLRRMQNTAIYQAIVREKGEQVFKDMDPEAVLR
EQRQRLDKERMETQRRLQQQDKTFDHYIRALHLEEMLERKAVMMKRMQEAPKLHEEYDCR
RIQKAVDDHNSAVNMWERLEEIREDAMDWISLVKESNADDFAKKTAEWTNKLNAVRAARL
QERAEQRKKERREKWNRAKVEEERRRREEEERQRQQLIEEQRRAAREPRIGDGAATPEMV
LEDNRSHLDFRSFFFDLGCQECSLYFTKPKEKGPNRREMDMDSKAMADSDWRGGMRERQT
MTNRPLPNRDRDVSDRPPMREREAPDRDDSWRRGMSSAAPLPPTNRERPPPAVLTNADKD
TSWRSNMAPAPPPPAAPTAPSAPSEGTWARGNVVKKDPASLNAGGKPSDGAKFIPSRLRN
QAAQQGGLPPRDMGPNRGDTRRVGTRGMGAESDTNWRRK
NT seq 3000 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaattcctttcaaaagcctgaaacagctctgaaaagggcacaagagcttatt
caagctcgtcgatacaaacaatggacccaaactcacgaactgataatgatgaagcatgtg
gagctctgtgttttactgaagaaacctcacgttgcaaaggatgccctatttcaatacaaa
acacttactcatcaggttgcagtgaagtcgttagaaaccgtaatagagcattttctacaa
atggcggaacaaaaaaccgaagaagcacagaaaacgtctattgagaaagtagaagaaata
gatgatcttgatcagggggacgttccggagacgctgctcctctccgttgtttccggcgct
gctgctcaagatcgagaattggatttctccgtcggctatcattgcgctctgttaagggtg
aaattgagctctccggagtctctaaccatgatgcaggagactcgtctatgtcagcttgat
actgctatacaaatggagctttggcaggaggcatatagaagtgctgaggatgttcatggc
atgatgcagctcagcaaagacaaggacaaacgaatggtgaagcctgcaagctacgttagc
tactacgataagcttgctcttgtattttggaaggctgggaatagccttttccacgcagct
gctctactgcaaaagtttatcatttacaaggacatgaagaagtcgttcacggccgaggag
gctcaagaacaagcaagccgtgtgcttcttgccactttatcaatccctgatggagccgat
gcaccgtcagatcttactcgtcatctcgatatagaggatcagcatctcactaatatacgc
ttgttgtcaaacctgttacgtcttccaattgctcctactcgggctggactgcttaaagaa
gctgcacgattaggcgttccagaaatggcatcagactccacaaatgcattatacaagcta
ctcgaaaataatttcgctcctttaaggcttgcacaagaggtggaggctcagctggtaaaa
atcgatcgtcccgaccatcttcagtatgtggatgcgctcaaagaagttgttgccactaag
gctctgaagcaaatatccgttatttacgattctataagttggaaccgagtgcagaagatt
attcctttctatagtgagatggagcttgagcgccttgttgtggacgtgagcaagcatcga
ttcgttaaggcccaaattgatcatcgcagtggttgcattcgatttggagctgcagacgta
acattagccggcggtgtcgatctagaagaagcagatggctttactggtgatgacgcgcag
ttgggtgtagaaggtattcgcacccatttggagctgatgtacaacaaactgcgttcgact
gtagaactattagacggtgacaagcgcactgaggctcttatagcaagggttaaacatcac
gcaattaactacgagcgcaccaagaacagcaagcaggaaactgaccgtatacttgagcgt
cgtcggaagattgagtactataaggaaacttcggaacgtgtcaaggctgaacgttcccag
caagctgctgctgaacttgctaaacgggaggaagctaaacgtgcggaggagatgaaacgt
cttgaacaagaaaatattgaaagcgagcgtaagcgaagactggcagagcaggaggaagtg
caaagaaaaatcaagcaagatcagctgcgtcgaatgcaaaatacggcgatctatcaagcg
attgtccgcgaaaaaggggagcaagtgtttaaagatatggatcccgaagctgtactcaga
gaacagaggcagcggttagataaggaacgaatggagacgcagcgtcgtcttcaacaacag
gataagacatttgatcactatatccgtgcattacatcttgaagaaatgctggaaagaaaa
gcggtcatgatgaaacgtatgcaagaagcaccgaaattacatgaagaatacgactgcagg
aggattcaaaaggcagtggacgatcacaacagtgcagtaaatatgtgggaacgtcttgag
gaaatacgtgaagacgctatggactggatttcgcttgtgaaggaatcgaatgctgatgac
tttgcaaagaagaccgccgaatggactaataagctcaacgctgttcgagctgcacgtctg
caagaaagagctgaacagagaaagaaggaacgacgagagaagtggaaccgggctaaagtg
gaagaggagcgtcgtcgtcgtgaggaagaggaacgccagcgccagcaactgatagaggaa
cagcgtcgagctgcacgagaacctcgaataggtgatggtgcagcgacgccagagatggta
ttagaagataatagaagccatctcgacttccgttccttcttctttgaccttggatgccaa
gaatgttcactctatttcacaaaaccgaaagaaaaaggtccaaatcgtcgtgaaatggat
atggattcgaaggcgatggcagattcagattggcgtggtggaatgcgtgaacgccagaca
atgaccaatcgtcctttaccaaatcgggatcgcgacgtctccgatcgtccaccaatgcgt
gaacgagaggcaccggatagggacgattcttggaggcgcggaatgagttcagctgctcca
ttgccacctactaatcgtgaacgtccaccgcccgctgttttgacgaatgccgataaagac
acgtcttggcgtagtaacatggctcctgctcctccaccaccagcagcacctactgctccg
agcgccccatcggaaggaacgtgggcgcgcggcaatgttgtgaaaaaagatcctgcttct
ttgaatgcgggtggaaagccttcagacggagcaaaattcattccttcgagattacgaaat
caagctgcacagcagggaggattaccgccacgtgacatgggacctaatcgtggagatacc
agaagagtcggaacccgtggaatgggcgctgaaagcgatacgaattggcgaaggaagtga

DBGET integrated database retrieval system