KEGG   Necator americanus: NECAME_03860Help
Entry
NECAME_03860      CDS       T04867                                 

Definition
(RefSeq) glutamate--tRNA ligase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
nai  Necator americanus
Pathway
nai00860  Porphyrin and chlorophyll metabolism
nai00970  Aminoacyl-tRNA biosynthesis
nai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NECAME_03860
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NECAME_03860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nai01007]
    NECAME_03860
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nai03016]
    NECAME_03860
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:nai02048]
    NECAME_03860
Enzymes [BR:nai01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     NECAME_03860
Amino acid related enzymes [BR:nai01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   NECAME_03860
Transfer RNA biogenesis [BR:nai03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NECAME_03860
 Prokaryotic Type
   Other AARSs
    NECAME_03860
Prokaryotic defense system [BR:nai02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    NECAME_03860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 25343894
NCBI-ProteinID: XP_013297172
UniProt: W2SZ17
Position
Unknown
AA seq 518 aa AA seqDB search
MVQFLSKRILHSVEQVRVRFAPSPTGHLHLGGLRTALYNFLFARHHKGRFILRIEDTDKA
RLVPGSAEEIQRVLTHYGLRYDEGPFAGGSFGPYVQSERLSFYQDAAARLIDSGDAYRCF
CSEDRLALLRKDAIRRNTTPKYDMKCRSIAEVESKARAAGGEPFVVRFKLDRQDVFFKVA
IPVVLFFVLYVDDVYGQIHQCIDESDMVILKTDGFPTYHLANIVDDQAMQISHVIRGMEW
LSSTGKHVLLYKAFGWQHPNWLHLPLITRDSKKKLSKRDKDAFVDFYELKLGALPLAVLN
LLIRNGSGIRDFDTTHLYSLEEMITSFDENEIGRRSLQLDQECLEKYGRMSVRAADVDDV
LLPAIKGLIARDLPSVVVPSDDYLRKVVGFLKLNEEAFAFLSSLTTGDFRWFLTKPLSAK
RVLSMFDHSAAVEALNILRDCDSLEPESIKRISENIGLPYTSLFTLVRVTLIDSSKGPPI
KELVSFFGINECKLRFQQMIEYLRSESVQSCTSIRRDT
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggtacaatttctgtcaaagagaattctgcattcggttgaacaggtgcgagtgagattt
gcgccaagtccaactggacatctgcatctcggaggtctgagaacagccctttacaacttt
ttatttgctcgtcaccacaaaggacgttttatactgcggatagaagacacggacaaagcg
cgattagttcctggaagcgccgaagagattcaaagagttcttactcactacggattacgg
tacgatgaaggccccttcgcaggaggatcattcgggccgtacgtacagtctgagagattg
tctttctaccaggatgctgcagccagattgattgattctggtgatgcctatcgatgcttc
tgctcggaggatcgtttggctctcttacgaaaagatgctattagaaggaacactacaccc
aaatatgatatgaagtgccgaagtattgccgaagtggaatccaaagcacgtgcagcgggt
ggggagccctttgttgttcgattcaagttagatagacaagacgtctttttcaaggtggcg
attccagttgttttgttttttgttttgtatgtggatgacgtgtacggccaaatacaccaa
tgcatcgacgagagtgatatggtgatactcaaaactgatggattcccaacctatcacctt
gctaatatagtagatgatcaagccatgcaaatttctcatgtcattcgcggaatggagtgg
ctgagcagtacaggaaaacacgtgcttctgtacaaagcttttggatggcagcatccgaat
tggctgcatctacctcttataacacgcgatagtaagaaaaaactatcaaaaagggataaa
gatgcgttcgtggacttttatgaattgaagttaggagcgcttccactggcagtgttgaat
ctactaattcgaaatggaagtggcattcgtgactttgatacaactcatctgtactctctt
gaagaaatgatcacatcgttcgatgagaatgagattggaaggcgtagtctgcagcttgat
caagagtgtctggaaaagtatggacgaatgtccgttcgtgctgccgatgtagacgatgtg
ttgctccccgccatcaaaggtctgattgcacgtgatctcccatcggttgtggttcccagc
gatgactaccttagaaaggttgttggtttcttgaaactcaatgaagaagcttttgcattt
ctctcgtctctgacgacgggagatttccgatggtttttaaccaaaccactatcggcgaaa
cgagttttgtctatgtttgaccatagcgcagcggtcgaggctctcaacattctgcgagat
tgtgattccctggaacctgaatcaatcaaaagaatatctgagaatatcggattgccgtac
accagtctcttcacattggttcgagtcactttaatcgacagcagtaaaggaccgcccatc
aaggaattggtctccttcttcgggattaacgaatgcaaactacggtttcagcagatgatc
gaatatctccgatctgaatcagtgcaatcctgcacgtcaattcgtagggacacgtaa

DBGET integrated database retrieval system