KEGG   Necator americanus: NECAME_07018Help
Entry
NECAME_07018      CDS       T04867                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
nai  Necator americanus
Pathway
nai00430  Taurine and hypotaurine metabolism
nai00480  Glutathione metabolism
nai00590  Arachidonic acid metabolism
nai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    NECAME_07018
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NECAME_07018
   00480 Glutathione metabolism
    NECAME_07018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nai01002]
    NECAME_07018
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nai04090]
    NECAME_07018
Enzymes [BR:nai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     NECAME_07018
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     NECAME_07018
    3.4.19.14  leukotriene-C4 hydrolase
     NECAME_07018
Peptidases and inhibitors [BR:nai01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   NECAME_07018
CD molecules [BR:nai04090]
 Proteins
  NECAME_07018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 25347049
NCBI-ProteinID: XP_013306424
UniProt: W2TT08
Position
Unknown
AA seq 300 aa AA seqDB search
GLLIKADLAGYETKIEKPHNIKLPNGFSIKGPTLPSSFLAIGIIVEIMMSRYSNRSEISL
DVNYLRDLLMAQRTALLRLEKSGDPDFAIYDPVVDTMGERRNNTLDDSDENFDEKDVNKL
LRNLKKFLLSTNFWKQEDFVGSHINVIDREHLAVALGSTINNRFGSVRRFEKGGFLWNNA
MSGFTIYDKEDSEDMHVNAVEGRKRPRTSMSPFMLFDANGKLLGCYGTTGSLNSILGISQ
VLLHRMLFDMDLKKSVDAPRIFATLEGAAFESGFQLVSEFFGRDIWNVCNRTDPKSSNGN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ggtcttctaatcaaagctgatcttgctggttacgagacgaaaattgaaaaacctcataat
attaaacttcccaacggattctctattaaaggacctacattgccgtcttcgtttttagca
attggcatcattgtagaaattatgatgagtcgctacagtaatcgttcagaaatctccctg
gatgttaattatctgagagatctgttaatggcgcagagaacggctcttctgcggcttgaa
aaatcaggtgatccagattttgcaatctatgatccagtagtggacacaatgggcgaacga
cgcaataacactttggatgactcagatgagaactttgacgagaaagacgtaaacaagctg
ttgcggaacctgaaaaaatttcttttatccactaatttttggaaacaagaggatttcgtc
ggctcccatatcaacgtcattgatcgggaacatttggctgttgcgttaggttcaactata
aacaataggttcggatcggttcggcgatttgaaaaaggtggtttcctatggaataacgca
atgtctggattcaccatttacgataaggaagatagcgaagatatgcacgtgaacgctgtg
gagggtaggaagcgtccgcgaacttccatgtcaccttttatgctattcgatgcgaatggt
aagctgcttggctgttacggaacgactggatccctgaattcgatccttggcatttcacaa
gttctgcttcatcgcatgctattcgacatggatctgaagaaatccgttgacgctccacgt
atttttgccaccttagaaggcgcggcctttgaaagtggatttcagctggtgagtgaattt
tttgggcgagatatctggaacgtatgcaataggactgatcccaaaagttctaatggaaat
tag

DBGET integrated database retrieval system