KEGG   Necator americanus: NECAME_09971Help
Entry
NECAME_09971      CDS       T04867                                 

Definition
(RefSeq) kinase domain protein
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
nai  Necator americanus
Brite
KEGG Orthology (KO) [BR:nai00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nai01001]
    NECAME_09971
Enzymes [BR:nai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     NECAME_09971
Protein kinases [BR:nai01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   NECAME_09971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase RIO1 APH YukC Seadorna_VP7 Lipocalin_9 Kdo
Motif
Other DBs
NCBI-GeneID: 25350000
NCBI-ProteinID: XP_013301392
UniProt: W2TAV0
Position
Unknown
AA seq 306 aa AA seqDB search
MYRNCKGKGHLFRRAEDSQTGIRRKVEAMEKYEKLGKIGEGSYGVVYKCRNRDNGQIVAI
KKFVETEDDPQIKKIALREIRMLKQLKHPNLVSLLEVFKRNRKLHLVFEHCDRTVLHDLE
KYPNGVPDELTKKITWQLLEALRFCHSHKCIHRDVKPENILLTKNDVVKLADFGFARIIN
PQEMYTDYVATRWYRSPEPDQQEPLPLRLPNATSVQLDFLYVSIKFHVELDTYQKCFEMS
PDRRWSAPELLQHSYFSGWQLRLRQEDINTSAIKKISNFQQPSTNYLPYLNGNIEFSRTC
QPWPIV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtaattgcaagggaaaaggacaccttttccgaagggctgaggatagtcagacg
ggaatccgacgaaaggtggaagcgatggaaaagtacgaaaaattggggaaaatcggtgaa
ggatcttatggtgtggtctacaagtgcagaaacagagataatggacagattgttgctata
aaaaaatttgtggaaacagaggacgatccacaaatcaaaaaaattgcgctgcgtgaaatt
cgaatgttaaagcaactgaaacatccgaatctcgtctcattattggaggttttcaagcgg
aataggaaactacatctggtgttcgagcattgtgatcgtaccgtgctacacgatctggag
aagtatccaaatggtgttcctgacgagttgacgaagaaaataacatggcagttgttggaa
gcgctacggttttgccattctcataaatgtatacatcgagatgtgaaacccgaaaatatt
ctgctaacaaaaaacgacgtcgtcaaactagccgacttcggattcgcacgaataattaat
ccgcaagaaatgtacaccgactacgtggccacacgatggtaccgaagtccagaacctgat
caacaggaaccattaccgctacgtttaccgaatgcaaccagtgttcagcttgatttttta
tacgtaagtattaaattccacgtagagctcgacacctaccagaaatgcttcgaaatgagc
ccggatcgacgatggagcgctcccgaattgttgcagcatagttactttagcggttggcag
ttgcgtttgcgacaagaggacattaatacatccgcgattaaaaaaatatccaattttcag
cagccttcaacgaattatctgccttacttgaacggaaacatagaattttcacgaacgtgt
cagccttggcctatagtttag

DBGET integrated database retrieval system