KEGG   Necator americanus: NECAME_12257Help
Entry
NECAME_12257      CDS       T04867                                 

Definition
(RefSeq) acyl-CoA dehydrogenase, middle domain protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
nai  Necator americanus
Pathway
nai00071  Fatty acid degradation
nai00410  beta-Alanine metabolism
nai00592  alpha-Linolenic acid metabolism
nai00640  Propanoate metabolism
nai01040  Biosynthesis of unsaturated fatty acids
nai01100  Metabolic pathways
nai01200  Carbon metabolism
nai01212  Fatty acid metabolism
nai04146  Peroxisome
Module
nai_M00087  beta-Oxidation
nai_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NECAME_12257
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NECAME_12257
   00592 alpha-Linolenic acid metabolism
    NECAME_12257
   01040 Biosynthesis of unsaturated fatty acids
    NECAME_12257
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NECAME_12257
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    NECAME_12257
Enzymes [BR:nai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     NECAME_12257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_ox_N Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 25352285
NCBI-ProteinID: XP_013297862
UniProt: W2T0V3
Position
Unknown
AA seq 566 aa AA seqDB search
MGRDLHPLSLHFVMFIPTLQGQTTDEQLDEWLSLAIARGIIGTYAQTELGHGTNLKNLET
TATYDPKTKEFIINSPTITSAKWWPGALGKSSNYAVVVAQLYTQGVCRGPHPFIVQLRDL
ETHKPLKGVRVGDIGPKFGFNSSDNGFLLFDNYRIPRNHMLMRHSKVEEDGTFIAPKHSK
LNYGTMVFVRSIMIKDQATQLAAATCIAIRYSAIRRQGEISQGCGEVQILDYQTQQFRLL
PQLARAFAFMFAAYEIRDLYMKVTEQLTQGNTELLPEIHALSSGLKSVVSWEAAQGIEQC
RLACGGHGYSLASAFPEIYAYSVGGCTYEGENIVMLLQVARFLMKAAEEVRSGSAHLAAI
CGYIGKPESVRSRFTTWDSYSDADIVHDFEHVAKKQVFRAYNALKRHQRESTPEEGWNRA
SIELCKASRMHVRLYLVKTFLQKIATTSEPSLRAPLTDLATLYVFDLITASQGEFTKGGF
MSDIQADAVREGIYRCLERLRPNAVSLVDSWDFDDAELHSVLGRRDGNVYPALLEWAQKS
QLNRTEVLPTFEKYLGPMMKDGRSKL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtgacctacatccgttatcgctacactttgtaatgttcattccgacgctacag
gggcagacaacggatgaacagctggatgaatggctgtccttagcgattgctcggggaatc
attgggacctacgcccaaaccgaacttggacatggaacgaatttgaagaatctggaaacg
acggccacctatgatccaaagaccaaagagttcatcatcaactcaccaaccataacctca
gccaaatggtggccaggtgcgttaggaaaatcctcgaattatgctgtagttgtggctcag
ctatacacccaaggcgtttgccgcgggccacatccgtttatagtacaactgagggatctg
gagactcacaaacccttaaaaggagtacgtgttggcgacataggtcccaaattcggattc
aactccagtgacaatggattcctactattcgataactacaggataccgcggaaccatatg
cttatgaggcattcaaaggttgaagaggacggtactttcatagcacccaagcattccaag
ttaaactacggaacgatggtattcgtcagatcgataatgatcaaagatcaggctacacaa
ctcgctgcagccacttgtatagcgattcgttactcggcaattcgaaggcaaggagaaatt
tcacaaggatgtggagaagtacaaatcctcgactaccaaacccaacagttccgtcttctg
ccacaactcgcacgtgcgttcgccttcatgttcgcagcatacgaaatccgagatctgtac
atgaaggtaactgagcaattaacacaagggaacactgagctcctgccagaaatccacgcg
ctgtcatcggggctgaaatccgtcgtctcgtgggaagcagcgcagggcattgaacagtgc
cgactggcttgcggaggacatggttactctctagcttctgctttcccagaaatttatgcc
tattcagtcggcggctgtacatatgagggtgaaaatattgtgatgctgcttcaagtcgcc
aggttcctaatgaaggctgctgaggaggtgcgtagtgggagcgctcatctggcagcgata
tgtggatacatcggtaagccagaatctgtccggtcccgatttactacgtgggacagctat
tcggatgcggatatcgtgcacgatttcgagcatgtggctaaaaagcaggtattccgtgcc
tacaatgccctaaaacgacaccagcgagaatcgacacctgaggagggatggaatcgtgct
tccatagaactgtgcaaggcatcgcggatgcatgttcgcctctacctcgtgaagaccttc
ctacaaaaaatcgccactacctcagaaccgtcactcagagctccgttgaccgatctggcc
accttatacgtattcgatttgataacagccagtcaaggagagttcacgaagggcggattt
atgtccgacattcaagcggatgctgttcgagaaggaatttatcgatgtctggaacggtta
cggccgaatgccgtgtctcttgtggacagttgggatttcgacgatgctgagctgcattca
gttcttggacgccgcgacggaaatgtctatccggctcttcttgaatgggcacagaaaagc
caattgaacagaactgaggtattgcctacgtttgagaaatacctcgggccaatgatgaag
gatggccgatcaaagctgtag

DBGET integrated database retrieval system