KEGG   Necator americanus: NECAME_12680Help
Entry
NECAME_12680      CDS       T04867                                 

Definition
(RefSeq) Choline/Carnitine O-acyltransferase
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
nai  Necator americanus
Pathway
nai00071  Fatty acid degradation
nai01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NECAME_12680
Enzymes [BR:nai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     NECAME_12680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf DUF1771
Motif
Other DBs
NCBI-GeneID: 25352708
NCBI-ProteinID: XP_013297096
UniProt: W2SZY7
Position
Unknown
AA seq 683 aa AA seqDB search
MLVASRPPPNYCRSKSLRSGSAADNSSLSPSCAVEFCAVVVRHETINGDVIFYHKHHLAG
DDYQFLQHSVIPSYHFQKSLRRLPIPKLTDTCNRFLASAKVVLSDTDYKQTETLVRNFEK
HEGPELQKALLDYDRNHKDTSYICETWFDIYLKSRLPCPVNYNPFMMYASDPDPHFNHQL
SRATNFAISFARFRRALDNNILAPEVFHLNPKKSDTKLFRSVCKALPPSLSWFGAVAFKA
FPLDMSQYKSTFNATRIPKKDKDVLYQDTTQKHFMVLYRGRIYTVHIFDDKGNILPAEHI
HNSLAHILKTGTQQESDKCIGALTSLERDSWANIREELLEAGNADKFRLIDGALFTLCLD
DLKSQDPSRLIQSLLIGDDASNRWFDKSFQLIVDGCGQATINFEHSWGDGVAVLRLMEES
YKDTNTHHFVTPDTVPQAASPGMVKEIEFNLTPSLRSHIDKAQKTHIQRNNVLDFSTMEY
DGLNKDTIKKSKMSPDSVMQLAIQMAFYSLYKEFVPTYESCSTAAFLKGRTECMRSATAA
TKEAALAFSAGKTEKAGELLSQCSNTHSQLVKEASMGQGFDRHLLGLKITAERLGKKVPS
LFEDSGFLRMGHFVLSTSTLSTNTIAFGGFGPVVQDGFGIGYNVSSSRLGAVITSHKKNR
DAKELSKALERNLDILKNIMKKT
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcgcatcgcgacctccaccgaattactgccgcagcaaaagtttgcgatctggt
tccgccgccgataatagctccctttcgcctagttgtgcagttgaattttgtgctgttgtt
gtccgccatgaaacaatcaatggagacgttattttctatcacaaacatcacctggccgga
gacgattatcagttcctgcagcacagcgtaattccttcgtaccatttccagaaaagtctc
cgacgtttgcccattccaaaactaacagatacttgcaatcgatttctagcctcggccaag
gtcgttctttccgatactgactacaagcaaacggaaacgttagtgcgaaatttcgagaag
catgaaggaccagaattacaaaaagcacttctggattatgaccgcaatcataaagatacc
agctatatctgcgagacctggttcgatatatacttgaaatcccgactaccgtgcccagtt
aactacaatccattcatgatgtacgcttccgatccagatcctcatttcaatcatcagctt
tctcgagctaccaactttgctatttcgttcgcccgcttcagacgtgcactggataataat
atactggctcccgaagtatttcatttgaatcccaaaaaaagtgacaccaaactgttccga
agtgtttgcaaagcacttcctcctagcctttcctggtttggagcggtagcattcaaagcc
ttcccactagacatgagtcaatacaagtcaacatttaatgcaactcgcatccctaagaag
gataaagatgtgttgtatcaggatacaacgcaaaaacattttatggttctttaccgtggc
agaatttacactgttcacatttttgacgacaaaggcaatatacttcctgccgaacacatc
cacaactctttggcgcatattctaaaaacaggcacgcaacaggaaagtgacaagtgcatc
ggtgcattaaccagtctggaacgcgactcatgggctaatatccgtgaggaattgttagaa
gctggtaatgctgataaatttcgtttgattgatggtgctcttttcacgttatgtttggac
gatctgaagtctcaagacccatctaggcttattcagtcccttctaattggagatgacgct
agtaaccgttggttcgacaagagtttccagcttatcgttgacgggtgtggtcaagctacg
attaacttcgaacattcttggggtgatggagttgctgtgctccgtctcatggaggagtcg
tacaaggatacgaatacgcaccattttgtaactcctgacaccgtaccccaagcagcatct
ccaggaatggtgaaagaaatcgaattcaaccttactccttcgttgcgatcacatatcgat
aaggcccaaaaaacgcatatacaaagaaacaacgtactcgacttttctacaatggagtat
gatggcttgaacaaggatacaattaagaagtcaaaaatgtctccagattccgttatgcag
ctagccattcaaatggcattctattctttgtacaaggaattcgttcccacatacgagtct
tgctccacggcagctttccttaaaggcaggacagagtgcatgcgctctgctactgccgct
acaaaagaagctgctctagcattttccgccggaaaaacagagaaagctggagaattgctg
tcgcaatgctccaacacacatagccaattggtgaaggaagcatcaatgggccaagggttc
gatagacacctactcggtctgaagatcactgctgaacgtcttgggaagaaggttccatct
ctttttgaggactccggatttcttcgtatgggtcattttgtactctctacaagcacttta
tctacgaacaccatagcgtttggcggattcggtcccgtagtgcaagatggtttcggcata
gggtataacgtgtcgtcatctcgacttggtgctgttattactagtcataagaagaatcgt
gacgcgaaggaactcagcaaggctttagagagaaatttggatattttgaagaacataatg
aaaaagacttga

DBGET integrated database retrieval system