KEGG   Necator americanus: NECAME_13078Help
Entry
NECAME_13078      CDS       T04867                                 

Definition
(RefSeq) kinase domain protein
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
nai  Necator americanus
Pathway
nai04010  MAPK signaling pathway
nai04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:nai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    NECAME_13078
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    NECAME_13078
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nai01001]
    NECAME_13078
Enzymes [BR:nai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NECAME_13078
Protein kinases [BR:nai01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   NECAME_13078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 25353106
NCBI-ProteinID: XP_013296511
UniProt: W2SX23
Position
Unknown
AA seq 349 aa AA seqDB search
MSYHTYPVTQDYRISRKVLGVGINGKVVECEHRITGEKYALKVLRDVPKARREVDLHYMA
SGHPNIVEIVDVYENSYNDVQCLLVVMESMKGGELFNRIQERGQQAFTEREAASIMFEIC
SAVAHLHKMNIAHRDIKPENLLYVDSGPNARLKLTDFGFAKRTDESEPLGLATACYTPYY
CAPEVLGAEKYDKSCDLWSIGVVMYILLCGYPPFFSQHGLPMSPGMKAKIKSGQYTFPSP
EWDCVSEAAKDLIKKLLKTDAAERITIEQTMQHKWITHYQKVPDTPLFTSSVLVDQKAQW
GEMQEEMEKTLASMRVGNENMQIKSLADSNNKLLQKRKQRAEETIQEAN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaccacacctatcccgtcactcaggactatcgcataagcagaaaggttcttgga
gtcgggatcaatggaaaagttgtagagtgtgaacatcgaattaccggagagaaatatgct
ctcaaagtacttcgagacgtaccgaaagccagaagagaggttgatctacactacatggca
agcgggcatccaaacattgtggaaatcgtcgacgtttacgagaattcctataatgatgtg
cagtgtcttcttgtagtaatggaaagtatgaaaggaggggaattgttcaaccgaattcag
gaacgtggtcaacaggctttcactgaaagagaagcagctagtatcatgtttgaaatttgc
tctgctgttgctcaccttcacaagatgaatattgctcacagagatataaaacctgagaac
cttctttacgtagactccggaccaaatgctcgactaaaattgacagattttggctttgca
aaaagaacagatgagtcggaaccgctcggattagcgacagcttgttatacgccatactac
tgtgctccggaagtgttgggtgccgaaaaatatgataaatcgtgtgacttgtggtcgata
ggagtcgttatgtacatattactatgcggttacccacctttcttttctcaacacgggctt
cctatgtctcctggaatgaaggctaaaataaaatctggtcaatacacttttccttctcca
gaatgggattgtgtatccgaagcagcaaaagatctgatcaagaaattgttgaaaaccgat
gcagctgagagaattacaatcgagcaaacaatgcagcacaaatggataacccattatcag
aaggttcctgacacccctctttttactagcagtgttctagttgaccaaaaggctcagtgg
ggtgaaatgcaggaagaaatggagaaaacgttggcatccatgcgtgttggaaacgaaaat
atgcagattaaaagccttgcagactccaataacaaactcctacaaaaacgaaagcagcgt
gcagaagaaacaatacaggaagcaaactaa

DBGET integrated database retrieval system