KEGG   Necator americanus: NECAME_13444Help
Entry
NECAME_13444      CDS       T04867                                 

Definition
(RefSeq) biotin--[acetyl-CoA-carboxylase] ligase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
nai  Necator americanus
Pathway
nai00780  Biotin metabolism
nai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NECAME_13444
Enzymes [BR:nai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     NECAME_13444
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     NECAME_13444
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     NECAME_13444
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     NECAME_13444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB PAN_4 BPL_C fn3_4
Motif
Other DBs
NCBI-GeneID: 25353472
NCBI-ProteinID: XP_013295989
UniProt: W2SYQ9
Position
Unknown
AA seq 403 aa AA seqDB search
MSYSVVLNKVKDMPLFLYMENSAHQASAIFSDATSEQLLAPGSRILHDSLSRVGVTVCET
EIPTLTPAVMIASEDDIIENMMGVRYGEEIGLVPRLFLRKTEKVGEQGMPDVTESVLPVE
VSSRNQKSSYTHFNFPLYFSHLRTRRLGHVILHIPVATTTMDVCESLCDAIPTCDGAVIV
AARQTHGQGRGGNEFVSPLGAAMFTVSTSLPQSCSLARTPSFVQHVFAVALVDAIRRLSG
FGDFPLRIKWPNDFYFNRSHKVGGLLATAKCRDDGLLVSIGAGINVSNSQPTVCLNDMVP
DGSDIKFSIEEVIAETLNRFEYWMNIYEMKGAGEVLKAYHEFWLHSREEVLLEELSEKVV
IRGLDKNGYLQVRSKSNPSKIFSVGDNGNTFDMMKGLIRHKLR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagctactcagtcgtgctaaacaaagtaaaagatatgcccctctttttgtatatggaa
aatagtgcacatcaagcttcggctattttttcagatgccacatctgaacagttgttagca
cctggcagtcggatacttcatgattcgttgtctcgtgttggcgtaacagtatgtgaaact
gaaattccaactcttactccagcagttatgatagctagcgaagacgacatcattgagaac
atgatgggagtacgatatggggaagaaattgggctagtaccacggctttttctccggaaa
acagaaaaggtgggagaacaaggaatgcctgatgttactgagagtgtgttacctgtggag
gtctcgtcacgcaaccagaagtcttcctacacacatttcaacttccccttgtacttctca
caccttcggacaagacgtctgggacacgtcattctgcacatacctgtcgctaccaccact
atggatgtatgtgaaagcctttgtgacgcaataccgacttgtgacggtgctgtgatagtt
gccgctcgtcagacgcatggtcaaggtcgtggtggaaatgaattcgtatctcctcttgga
gctgcaatgttcactgtttctacttctctcccgcagtcgtgttcattagctcgaactcca
tcatttgttcagcatgtctttgctgttgcattggttgatgctattcgtcggttaagtggt
tttggagatttcccactacgaatcaaatggccaaatgacttttactttaaccgctcacac
aaggtcggcggtcttttagctactgctaagtgtcgtgatgatggtctgttggtatcaatc
ggtgccggcatcaatgtatccaattcgcaaccaacagtttgtctcaacgacatggttcca
gatggaagcgacatcaaattcagcattgaagaggttattgccgagacgttgaatagattc
gaatattggatgaatatctacgaaatgaaaggtgctggtgaagtgctcaaagcataccac
gagttttggttgcacagccgagaagaagtgctgctcgaggagctgtctgagaaagttgtc
attcgggggttggacaaaaatggataccttcaagtgcgaagcaaaagcaatcctagtaag
atattttcggttggtgataatgggaacacatttgacatgatgaaaggtctgattcgacat
aaacttcgttag

DBGET integrated database retrieval system