KEGG   Necator americanus: NECAME_13473Help
Entry
NECAME_13473      CDS       T04867                                 

Definition
(RefSeq) dedicator of cytokinesis
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
nai  Necator americanus
Brite
KEGG Orthology (KO) [BR:nai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nai04131]
    NECAME_13473
Membrane trafficking [BR:nai04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    NECAME_13473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 Metal_resist
Motif
Other DBs
NCBI-GeneID: 25353501
NCBI-ProteinID: XP_013295788
UniProt: W2SXF9
Position
Unknown
AA seq 820 aa AA seqDB search
MFREESLRTIINWDLFATLDGFWKESAVDNIDMDYYRLLLACFCWVLKNVDGSALRHWVR
ELPPTRLTQLLNVLQLSVSCFEYKPGKFGDVVTNGVDPDETLTECVVTRRDGVRWRVAPP
SAVFEDEALLEAALCTEVVLCVLDTLETIIRVISMPGSDHLHFALPMILRSMMHMFACNQ
SVQALECIFVSQRTLVKKFSDVIFEQEAEQCGELCLQLLRHCASRLPAVRSQAAASLYLL
MRESYENGSSLARVKMQITMSLSTLVSNATKEGVWLNEDCLRRSLKTVLIYAETDANTDS
HTRANSNFSEQVKDLVLNIHMILSDTVKLKEFANDFEMTIDLMYRVAKGYQTNPDLRLTW
LLNMASRHADRELYCEAGQCVLHAAALAAEYLGMTFPNQISRQICLNFATRARILVFTAM
STTDSFMPRGAVDFEHISDNILEESAVSDDVLSPDVEGICESRHFTAAGLVNLVEKSMTF
FEKAHMYEIMPDVFRIVEPIVRDWRDYRRLGAIYARLSEALSRIEPTVTITEDTADAWLS
PLTSADKRCFGTYFRVGFYGSRFGDLDGEEYVYKVVRSSLQQSKAYLQITYVEPYFEKWE
RRRRLTHFERSHKIKRFVYATPFTRDGKAHGDLKDQFKRRTILSTQYSFPYVKTRIKVVE
REQKVLQPIQVAIDDIEKKTRELAAAIAQNPPDAKMLQMVLQGCIGTTVNQGPIQVANVF
LTDVALNEFGKPIDKLQNKLRLCFRDFSKKCADALTLNKNLILPDQLAYQTELQKNYVEF
TRRMAPIIGCNGSHHERKEVTTHAEHAVAVAAEIGPVTSV
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgttcagagaagaaagtctccgaactatcattaactgggatctcttcgctactctggac
ggattttggaaggaatctgcagtggacaacatcgacatggactactaccggctccttctg
gcttgtttttgttgggtcttgaagaacgtggacggctccgcactacgtcactgggttcga
gaactgccgccgacacgattaacccagcttttaaatgttctccagctttctgtctcgtgt
ttcgagtacaagcccggaaaatttggggacgttgtaaccaatggcgtcgatcctgacgaa
acattgacagagtgtgtagtaacacgacgtgacggtgtcagatggcgggtagcaccacct
tcagctgtattcgaagacgaagcgctgttggaagctgcactttgcacggaggtggtgttg
tgcgtcttggatacattggaaacgatcattcgagtgatttctatgcctggcagcgatcac
ttgcattttgccttaccgatgatattaaggagcatgatgcatatgtttgcgtgcaatcag
tcggtgcaggcgctcgaatgcatattcgtaagtcaacgcacgctagtgaagaaattctca
gatgtaatatttgagcaggaagctgaacaatgtggagagctgtgtctccaattgcttcgt
cactgtgcctctcgacttccagcagttcgttcacaggctgccgcgagtttatatcttctg
atgcgagagagctatgaaaatggcagcagtttggcgagagtaaaaatgcagatcacaatg
tcactgtcaaccttagtctcgaatgctactaaggaaggtgtttggctgaatgaagactgc
ttaaggagaagtctaaagactgtgcttatctacgcagaaacagacgccaatacagattct
catacacgtgcgaattcgaatttttcggagcaggtgaaagatcttgtcttgaacatccac
atgatactgtcggatactgttaaattgaaagagtttgcgaatgacttcgagatgacaata
gacctaatgtatcgtgtagctaaaggatatcagacaaatccggatctgaggctgacttgg
ttgctgaacatggcctcccgacatgctgatcgtgagctctactgtgaggctggacagtgc
gttcttcacgctgctgctcttgctgctgaatacttaggtatgactttccccaaccagatt
tcccgacagatttgtttaaatttcgcaacccgtgcaagaattttggtcttcacagctatg
agcactactgatagttttatgcctcgtggagcagtcgacttcgagcacatcagtgacaac
atccttgaagaaagtgcagtcagcgatgacgtactgagtcctgatgtggaaggaatttgc
gagtctcgtcatttcactgcagctggcttagtaaatcttgttgaaaagtctatgactttc
tttgagaaagctcatatgtatgagatcatgccggatgtgttccgtatagtggaacctatc
gtgcgtgattggcgtgactatcgtcgactaggagctatatacgctcgactgagcgaagcg
cttagtagaattgaaccaactgttacaattaccgaggatactgccgacgcatggctgtcc
ccactaacgagtgctgataaacgatgcttcggcacatatttccgagttggattttatggc
tcccgattcggtgatttggacggagaggagtatgtctacaaggtggtgagaagctcatta
caacaatcaaaagcctatcttcaaataacctatgtggaaccctactttgaaaaatgggag
aggagaagacggcttacacacttcgaacgtagtcataaaattaagaggttcgtttatgca
acaccattcactcgcgacggaaaagcacacggtgatctgaaggaccaattcaagcggcgc
acaatactctctacccaatatagttttccttatgtgaaaacgcgtataaaggttgtggag
cgcgaacaaaaagttctgcagccaattcaagtggctatcgacgatatcgagaagaaaacg
agggaactggctgctgcgatagctcaaaatcctcccgacgcaaagatgctgcagatggtg
ttacaaggatgtataggaactacagttaatcagggccctattcaggtagccaatgtgttc
ctaacagatgttgcactaaatgaatttggaaaacctatagacaaactgcaaaacaaacta
agactttgtttccgtgatttctccaagaaatgtgcggacgcactcaccctcaacaagaat
ctcattcttccggaccaactggcttatcagaccgaactacaaaagaactatgtggaattt
actcgtcgaatggctccaatcatcggttgcaacggcagccatcacgagcgaaaagaagtg
accactcatgccgagcatgcagtagctgtagcagcggagattggtccggtgacctctgtg
tga

DBGET integrated database retrieval system