KEGG   Necator americanus: NECAME_15702Help
Entry
NECAME_15702      CDS       T04867                                 

Definition
(RefSeq) hypothetical protein
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
nai  Necator americanus
Pathway
nai00562  Inositol phosphate metabolism
nai01100  Metabolic pathways
nai04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    NECAME_15702
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    NECAME_15702
Enzymes [BR:nai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     NECAME_15702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PX C2 PI3K_C2 DUF4135 TAN PRD
Motif
Other DBs
NCBI-GeneID: 25355728
NCBI-ProteinID: XP_013290870
UniProt: W2SGG9
Position
Unknown
AA seq 1282 aa AA seqDB search
MCSIYLLVATVITRSWSEYSVRFRWPRNEDVERAYTCATDTLVEHLITQLLADLLNESEL
VDGVPVERFGLKIFGLDEFIPKTSPLGHNLYVGNCILHGKDVKLEIGRFEPSFIRSTSPS
PPWEKMKTQIKFSSILDKEDIENMMLHLKSEMNEYEVAFHSSSTLRISSTSNKVRQCVKM
LCKLINSIEPISLHQHLQNYLTAATIDQLRCSRNDFIASLHSLISVYCQCTLSSYKLTPI
RPLDKPKKEVLHCKEKLKVVVNSVHNLMEEWMRDYTEFFINVNVYYGTQVLAGNNKCISK
TVKHDAFFPYIPMNVYVYFEDMLCTCPRETKIMFILSGFSIVPNTGSEGGSESTRRPLAF
ASLPLFDHELTLRQGQLFIPLTVLKDPVLKPWGPYPLIANEKDPILIVTLPTYEHQVIFP
EVVVEYQSVKQDPSSLDCETHEFLMSLVEAGDTNNLKPDEQEMLWQKRSYLMHLPEALPL
VLSSVTDWGFYFLANVYQILEDWAPLSPVQAMQLLLPQYPDKRVRQKAIEWILCASSDFL
FNALPQLVEALRFEIFESSSLAVALLSLSYKDRRFAFEIYWQLQQRIDHCVDFAYAQRCS
LLQKELLERHEPDHLRDEIARQHRLLNELDCIQMDLRREDSDQARAKRSLSTILRHYFTF
NCILTGFLQLSLLRSRLGALDGSLLHHNVRLPCMPSFRCSGVVVKECKIFNSNAKPLKIV
FRGLNSTYSIIHKSGDDMRQDALVLQMVAFMNDIWLSEHLDLRMITFRCMPVGYRKGMAE
LVSDCATLCEIQKEFGMTGVFKVDVLRNWLMKHNTTEFLYKQALDNFTRSCAGWCVATYV
LGIGDRHNDNILVTTAGHVFHIDFGKYMGDWQTAAGFRRDRVPFVFTDEMYHVINGGNQQ
KESYQTFIDYCCWAFNYLRRNYIILANLLKIMACSDISGMNVESLNFVEKNLMLELSETD
AVIQFTQLINHSLKSAFPRINFFFHTLAQVMTSTAASAKNSDTALSFLYKIEVIRVSETV
STFVYRSFNEFNELYIKLRRRFPTVAFPALSPGTRMRSNVREVAQRRMVDVESFLRYLFT
LSPEVCHFGVNEVFQCDLVYTFFHLILRDNDIDSYIDTEEMHADAHRNQCEVYLKIQFND
SKQRSQLSIFIGHVKHLALLTTGQAPDAYVKAYIRPDPQNLTKRKTQVVKASQNPTFNRE
VCFVYVLCTFYCCIFQLYYDIMDGEHVLSTRVLEVSVWNCGGLMDNNKMYMLYIPLQKLK
NQPEDRKGNRVLEGWFAFDKNI
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagtatttatttgctagttgctaccgtgataacccgttcgtggtcagaatattcg
gtacgttttaggtggcctcgtaatgaagacgttgaacgggcgtacacttgtgctacagac
accttagtagaacatctcattactcagctgcttgctgacttgctgaatgagtcagaactt
gttgatggcgtaccagttgaaagatttggtctcaagatttttggactggacgaattcatc
ccaaaaacgtcccctttagggcataacctgtatgttggcaattgcatcctccatgggaaa
gatgtgaagctagagattggtcggtttgagccttcctttattcgatcaacaagcccgtcg
ccaccttgggaaaagatgaaaactcaaataaaattctcttcgattttggacaaggaggat
attgaaaatatgatgcttcatctcaaatctgaaatgaatgagtatgaggttgcatttcac
tcatcatctacgctcagaatttcatctacgtccaataaggttcgacagtgtgtaaaaatg
ctgtgcaagttgatcaattccattgaacctatcagtcttcatcaacatctccaaaactac
ttaacggcagccacaatagatcaattaagatgttcgcgcaacgattttatcgcttcactg
cacagtctcatctcggtctattgccaatgtactcttagttcgtacaaattgacgcctata
aggccattagataaaccaaaaaaagaagttctacactgtaaagaaaaactaaaagtcgtt
gtgaattccgttcataatttgatggaggagtggatgagggattatactgaatttttcatt
aatgtcaatgtatactacgggacacaagttttagctggcaataacaaatgtatttcgaaa
actgttaagcatgacgcattctttccgtatattcctatgaatgtttatgtttacttcgag
gacatgttgtgcacatgtccaagagagacgaagattatgtttattttgtcgggattttca
atagtgcccaacactggctcagagggaggttcggaaagcacacggcgaccgttggctttt
gcatcactaccactgtttgatcacgagttgacactgagacaaggacaactttttattcct
ttgacggtcctcaaagatcctgtcttgaagccatgggggccttatcctcttattgctaac
gaaaaagatccgatccttattgttactttaccaacgtacgagcatcaagtgatatttcct
gaagttgttgttgaataccaaagtgttaaacaggatccatcgtcactagactgtgaaact
catgagttcctaatgagtttggttgaagctggagacactaacaatctcaaacctgacgag
caggagatgttgtggcagaagcggtcatatctcatgcatttgccagaagcactaccttta
gtattatcatccgttaccgactggggcttctatttccttgccaatgtttatcagatcctt
gaggattgggcacctctttcacctgttcaagccatgcaacttttacttccacaatatcca
gacaagcgtgtaaggcaaaaagcaattgagtggattctttgtgcttcgtcagattttctg
ttcaatgctttgccgcagctagtcgaagctcttcgctttgagattttcgaatcgtcttct
cttgctgtggcgctgctttcattatcttacaaggatagaagatttgcattcgaaatctac
tggcagttacagcaacggattgatcactgtgtggattttgcatatgctcagcgatgttca
ttattgcaaaaagaactactcgaaagacatgaaccggatcatttgagggacgagattgct
cgacaacatagactactaaatgagcttgactgcatccaaatggaccttcgaagagaggat
tctgaccaagcacgggcaaaacgttcactttctaccatattgcgacattactttaccttt
aattgtattcttacggggtttttgcagctttcattgcttcgttcacgtcttggcgcattg
gatggatctctgctccatcacaacgttcggctaccgtgtatgccatcatttcgatgtagt
ggtgttgttgtcaaagaatgtaaaatttttaactcgaacgctaaacctctcaaaatcgta
tttcgtggtctcaactctacttactccataatacataagagcggtgatgacatgaggcag
gatgccttagtgctacaaatggttgcgttcatgaacgatatttggttaagcgaacatctc
gatcttcgtatgattacttttcggtgcatgcctgttggttataggaaaggaatggctgaa
ttagtatcagactgtgcaactttatgcgaaatccaaaaagaatttggaatgactggtgtt
ttcaaagttgatgttttgagaaattggttgatgaagcataacacaactgagttcttatac
aaacaggctttggacaactttactcggtcttgtgctggttggtgtgttgcgacgtacgta
ttgggtatcggtgatcgccataatgacaacatacttgtgacaacagctggtcatgttttc
catattgactttgggaagtacatgggtgactggcaaacagctgctgggttcaggagggat
cgtgtgccttttgtcttcaccgatgaaatgtaccatgtaattaacggcggaaatcaacag
aaagaaagctatcagacttttatcgattactgctgttgggctttcaactacctacggcgg
aactatattatcctcgccaatcttctgaagattatggcttgctccgacatatctggtatg
aatgtagagtctttgaattttgttgagaagaacctaatgttagaactgagtgagaccgat
gctgttattcaattcacgcaactaataaatcattcactcaaatcggcgttccctcgaata
aatttctttttccatactttggcacaagtaatgacatccacggctgcttcggcgaagaat
agcgataccgccctcagttttctttataaaatagaggtcattcgcgtatcagaaactgtg
tcaacctttgtctatcgatctttcaacgaattcaatgaactgtacattaaactgcgtcgg
agatttcctactgttgcatttccggcgcttagtccgggaacaaggatgcggtcgaatgtt
cgagaggtagcgcaaagacgaatggttgatgttgaatcgttcttacgatacctgtttaca
cttagcccggaagtgtgtcattttggggtaaacgaggtgtttcagtgcgatttggtgtac
actttcttccatcttattcttcgagacaacgatatcgactcatatatagacaccgaagag
atgcatgcagatgcgcaccgtaatcaatgcgaagtgtatttgaaaattcaattcaacgac
agcaaacaacgctcacaattgagtatattcataggacatgtgaaacatttggcgcttctc
accactggtcaagctccggacgcatacgtgaaagcatacatccgtcctgatccacaaaat
ctaacaaaacggaaaacacaagttgttaaagctagccaaaatccgacgttcaatcgagag
gtgtgctttgtgtacgtgctttgtacgttctattgttgtatatttcagctttactatgat
ataatggatggagagcatgtgctatccacacgagtgctagaagtatccgtgtggaattgc
ggcggtttaatggataataataaaatgtatatgctgtacattccactgcagaaattaaag
aatcaacctgaggatcgcaagggaaatcgagttcttgaaggatggtttgcgttcgacaaa
aatatatga

DBGET integrated database retrieval system