KEGG   Necator americanus: NECAME_15955Help
Entry
NECAME_15955      CDS       T04867                                 

Definition
(RefSeq) CoA-ligase
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
nai  Necator americanus
Pathway
nai00020  Citrate cycle (TCA cycle)
nai00640  Propanoate metabolism
nai01100  Metabolic pathways
nai01200  Carbon metabolism
Module
nai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NECAME_15955
   00640 Propanoate metabolism
    NECAME_15955
Enzymes [BR:nai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     NECAME_15955
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NECAME_15955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-GeneID: 25355981
NCBI-ProteinID: XP_013290434
UniProt: W2SHI3
Position
Unknown
AA seq 160 aa AA seqDB search
MPGQIHKKGCIGIVSRSGTLTYEAVHQTTLAGLGQTLCVGIGGDPFNGTNFIDCLDIFMK
DPNTKGIILIGEIGGVAEEQAAQFIKDHNSKGQGKPVVAFIAGLTAPPGRRMGHAGAIIA
GGKGTATDKIEALRAAGVHVTDSPATLGSTMAQVLIHGSP
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtcagattcataagaaaggatgcataggtattgtgtcacgttcgggaactctg
acctacgaagcggtacaccagacgacattagccggtcttgggcaaacactatgtgtcggg
attggaggtgatccgttcaacggaaccaatttcattgactgtctcgatattttcatgaag
gatcctaataccaaagggataatacttattggcgaaattggcggcgtcgcagaagagcaa
gcagcacaattcataaaagatcacaacagcaaaggccaaggaaagccagttgttgcattt
atcgcaggtcttacagctccaccgggaagacgcatgggtcacgcaggagcgattattgct
ggaggaaaaggaacggctaccgacaagatagaggcactgagagctgctggcgttcacgtt
accgattcgccggccacgcttggctcaactatggctcaagtgctgatccatggcagccct
tga

DBGET integrated database retrieval system