KEGG   Necator americanus: NECAME_16774Help
Entry
NECAME_16774      CDS       T04867                                 

Definition
(RefSeq) tRNA ligase class I
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nai  Necator americanus
Pathway
nai00450  Selenocompound metabolism
nai00970  Aminoacyl-tRNA biosynthesis
nai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NECAME_16774
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NECAME_16774
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nai01007]
    NECAME_16774
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nai03016]
    NECAME_16774
Enzymes [BR:nai01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NECAME_16774
Amino acid related enzymes [BR:nai01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NECAME_16774
Transfer RNA biogenesis [BR:nai03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NECAME_16774
 Prokaryotic type
   Other AARSs
    NECAME_16774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f ELYS
Motif
Other DBs
NCBI-GeneID: 25356800
NCBI-ProteinID: XP_013307641
UniProt: W2TUU7
Position
Unknown
AA seq 227 aa AA seqDB search
VKLGISHKAFSDVIRPKHYLQFILQDLEWDGDLSISRSRTRLPWGIVVPDDDTQTVYVWL
DALVNYLSVIGYLKTMDVWPPTCQILGKDIMKFHAFYWPAFLMAIELPLPKKLFVHGHWL
VDNAKMSKSVGNVIDPHVAMKSYTTEGLRYFLLKQGLPHGDSNFSREKAINVINSDLVNN
IGNLLSRATVKKLNPTQKYHDFVPNVLNGDLADMAGSLLKELTEIRG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtcaaacttggcatttcacataaagcgttttcagatgtaattcgccctaaacattatctc
caatttattctacaagatcttgaatgggatggtgacctgtccatttcccgaagtcgcaca
cgactaccatggggtatagtagttcctgatgacgacacgcaaaccgtctatgtatggctt
gacgccctcgtgaactatctttccgttattgggtatcttaaaacgatggatgtttggcct
cctacctgccaaattcttggaaaggacataatgaaatttcacgctttttactggccagcg
tttctgatggccattgaactaccactacctaagaagctttttgttcatggtcattggctc
gttgacaatgccaagatgtcaaaaagtgtcggcaacgtcattgatccgcatgttgcaatg
aaatcatacacgacggaaggcttgcggtatttcttactgaaacaaggattgccacatgga
gattctaatttttcacgggaaaaggctatcaacgtcattaacagcgacttggtcaacaat
ataggaaatcttctgagcagagcaactgtgaagaagctcaatccaacccagaaataccac
gattttgttccaaatgttttgaatggagatcttgcagacatggcaggctctcttttgaaa
gagttgactgaaattcgaggttag

DBGET integrated database retrieval system