KEGG   Natronolimnobius aegyptiacus JW/NM-HA 15: B1756_06410Help
Entry
B1756_06410       CDS       T04999                                 

Definition
(GenBank) NAD-dependent epimerase
  KO
K19243  NAD+ dependent glucose-6-phosphate dehydrogenase [EC:1.1.1.388]
Organism
naj  Natronolimnobius aegyptiacus JW/NM-HA 15
Pathway
naj00030  Pentose phosphate pathway
naj01100  Metabolic pathways
naj01110  Biosynthesis of secondary metabolites
naj01120  Microbial metabolism in diverse environments
naj01130  Biosynthesis of antibiotics
naj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:naj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B1756_06410
Enzymes [BR:naj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.388  glucose-6-phosphate dehydrogenase (NAD+)
     B1756_06410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_4 Sacchrp_dh_NADP RmlD_sub_bind NmrA
Motif
Other DBs
NCBI-ProteinID: ARS89418
UniProt: A0A2Z2I008
Position
complement(1285054..1285800)
Genome map
AA seq 248 aa AA seqDB search
MAQSVLLTGAMGGVGQAILGGIADDHEWRLLDRDPPTEEQPGEFVVADITDEEAVREAME
GIDVVIHLAGDPRKTAAWESVLPNNIDGTQTVYEAAVDAGVEKVAFASSNHAVGGYETDE
RTPDMYRTNDEFCLDGTELPRPGNLYGVSKVTGEALGRYYHDEYGISVVNVRIGNLTKGH
PPIDYERGQAMWLSYRDCAHLFDRCIRADYDYEIVYGISDNDRKYYSIERAKDVLGYEPR
DNSAEHEY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcacagtcggtcctgctcacgggggcgatgggcggcgtcgggcaggcgatcctcggc
gggatcgcagacgaccacgagtggcgcttgctcgatcgtgacccgccgaccgaggagcaa
ccgggggagttcgtcgtcgcagacatcaccgacgaggaggccgtccgggaagcgatggag
ggaatcgacgtggtgattcacctcgcgggtgacccccggaagaccgccgcctgggagagc
gtcctgccgaacaacatcgacggcacccagacggtctacgaggcggccgtcgacgctggc
gtcgagaaggtggccttcgcctcctcgaaccacgccgtcggtgggtacgaaaccgacgag
cgcacgcctgacatgtaccgcaccaacgacgagttctgtctcgacgggaccgaactcccg
cggccggggaacctttacggcgtctcgaaggtcaccggcgaggccctcggtcgctactac
cacgacgagtacggcatctccgtcgtcaacgtccgcatcggcaacctcacgaagggccac
ccgccgatcgactacgagcgcggccaggccatgtggctctcatatcgcgactgcgcccac
ctcttcgatcgctgcatccgcgccgactacgactacgagatcgtctacggaatctccgac
aacgaccgcaagtactactcgatcgagcgcgcgaaagacgtgctgggctacgagccccgg
gacaactcggccgagcacgagtattga

DBGET integrated database retrieval system