KEGG   Natronolimnobius aegyptiacus JW/NM-HA 15: B1756_07025Help
Entry
B1756_07025       CDS       T04999                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
naj  Natronolimnobius aegyptiacus JW/NM-HA 15
Brite
KEGG Orthology (KO) [BR:naj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B1756_07025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ARS89517
UniProt: A0A2Z2HVF9
Position
1413820..1415028
Genome map
AA seq 402 aa AA seqDB search
MIDWALLVGVLVACFVAYNIGGATTGPAFGPAVGADVLSKTTAAALMSVSFFAGAFTIGR
RVVDTLGEDIVTDPSVFTLEASIVVLGFIGLALLVGNITGVPASTSMTAVGAIAGLAVAG
GVLNRPVLTEIVSWWILGPVIGFWVSVMIGRYLYPHVDRLIAIDRTDEPLVTIDRTGSVP
KPAVHEDASRRELVGAAIVVGIGCLMAFSSGASNIANAIAPLVGSGQLAMNPGIVVGSAA
VAVGAFTIARRTMESLGNDITDLPLTAAIIVAVVSSTIVVFLSAIGIPVQFVIIATLSIV
GLGWGRATRTVTIADAVRRQDVPVTAGGLQMDAEAPTVGEPDLESDSADDVDPIGEESPE
TVPAASDLFDLGVTARIVVMQSIVPVLATIGCYLTFEFVVFA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgactgggcgttactggtgggcgtactcgtggcgtgtttcgtcgcgtacaacatc
ggcggggcgacgaccggaccagcgttcggaccggccgtgggtgcggacgtgctaagcaag
accacggcggcggcgctgatgtcagtctcgttcttcgcaggtgcgttcactatcggtcgc
cgcgtcgtcgacacgctcggcgaagacatcgtcaccgatccaagcgtgtttacgctcgag
gccagtatcgtcgtgctcggattcatcggtctcgcgctgctggtcggcaacatcacgggc
gtgccggcgtcgacctcgatgactgcagtcggggcaatcgccgggctcgccgtcgctggc
ggagtgctcaaccgcccggtgctgaccgagatcgtctcgtggtggatcctcggtcccgtg
atcggcttctgggtctcggtgatgatcggtcggtacctctatccacacgtggatcggctt
atcgcgatcgatcgaacggacgagccgctggtgacgatcgaccgaacgggatcggtaccg
aaaccggcggttcacgaggatgcgagccgacgcgagctcgtcggcgcggcgatcgtcgtc
gggatcggctgtctgatggcgttcagttcaggcgcgagcaacatcgcgaacgcgatcgca
ccgctggtcggcagcgggcaactggcgatgaatcccgggatcgtcgtcggctcggcggcc
gtcgccgtcggcgcgttcacgatcgccagacggacgatggaatcactcggcaacgacatc
accgacctgccgctgacggccgcgatcatcgtcgccgtcgtcagttcgacgatcgtcgtc
ttcctctcggcgatcggcatcccggtccagttcgtcatcatcgccacgttgagcatcgtc
ggactcggctggggccgcgccacgcgaaccgtgactatcgccgacgcggtccgtcggcag
gacgttcccgtgactgccggtggcctccagatggacgcggaggccccgacggtcggcgag
cccgacctcgagagtgactccgctgacgacgtcgatccgatcggcgaggagtcaccggag
acggttcccgcagcgtcggacctcttcgatctcggggtgaccgcgcgaatcgtcgtgatg
cagtcgatcgtcccggtcctcgcgacgatcggctgttatctgaccttcgagttcgtggtg
ttcgcctga

DBGET integrated database retrieval system