KEGG   Nakamurella sp. s14-144: EH165_02765Help
Entry
EH165_02765       CDS       T05729                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
nak  Nakamurella sp. s14-144
Pathway
nak00564  Glycerophospholipid metabolism
nak01100  Metabolic pathways
nak01110  Biosynthesis of secondary metabolites
Module
nak_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:nak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EH165_02765
Enzymes [BR:nak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     EH165_02765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AZI57239
UniProt: A0A3G8ZIQ2
Position
complement(630882..631637)
Genome map
AA seq 251 aa AA seqDB search
MADDHTPSSIAHIASLVRSSVPPMHPGGRPIVFGVAGATLLVRSLFRAVGLKTAGKVWTR
LGLLATAGCAAFFRAPVRVTPQRPDLVFAAGDGVVSLIEDAVPPAELNLGAAPRPRVSIF
LSVLDVHVQRIPISGTVTKAAYHPGKFLSADLDKASEDNERNSLLITTADGTEIVVVQIA
GLLARRIVCDVHQGEKVRAGQMYGLIRFGSRVDTYLPVGAVPTVVIGQRTIGGETMLADL
SQRAAATFTAL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaccacacacccagctccatcgcccatatagcctctttggttcgctcgtcg
gttccgccgatgcatccgggtggtcgacccatcgtgttcggcgtcgcaggagcaaccctg
ttggtgcgcagcctctttcgcgcggtgggccttaaaacagcgggaaaggtgtggactcga
ctgggcttgttggcaaccgctggctgcgccgcatttttccgcgctcccgtgcgggtcacg
ccgcagcgccctgacctcgtcttcgccgcgggcgatggtgttgtgtcgctgattgaagac
gcggtgccacccgccgagctcaatcttggcgccgccccgcggccccgagtgtcgatcttc
ctgtcggtccttgacgtacatgtgcaacgaattcccattagcggcactgtgaccaaagcc
gcttatcatcccggcaagtttctctctgccgacctcgataaggcctctgaggacaacgag
cgcaactcacttctcatcaccaccgcggatggcacagaaatagtggtcgtccagatcgcg
ggtttgctggcgcgccggattgtgtgcgacgtccatcagggtgaaaaggttcgcgccgga
cagatgtacggtctgattcgattcggttcgcgggttgacacctaccttccggtcggcgcc
gtacccacggtggttatcggccagcggaccatcggcggggagacaatgttggctgatctt
tcgcagcgggcagcggcaactttcaccgctttatga

DBGET integrated database retrieval system