KEGG   Nakamurella sp. s14-144: EH165_06215Help
Entry
EH165_06215       CDS       T05729                                 

Definition
(GenBank) RluA family pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
nak  Nakamurella sp. s14-144
Brite
KEGG Orthology (KO) [BR:nak00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nak03009]
    EH165_06215
Enzymes [BR:nak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     EH165_06215
Ribosome biogenesis [BR:nak03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    EH165_06215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 ComX
Motif
Other DBs
NCBI-ProteinID: AZI57802
UniProt: A0A3G8ZKG2
Position
1402046..1402972
Genome map
AA seq 308 aa AA seqDB search
MSELRSLPVPDGLAGERVDAGLARLLGMSRTAVAAIIDGGGVQIDGAVVPRSERLLPGSW
LEITLPELERRPPVVVADVTGLGLLYEDEDIVVVDKPVGVAAHSSPGWDGPTVTGVLAAR
GVAVARVGAQERQGIVHRLDVGTTGAMVVAKSHRAYTALKTAFKERTVEKIYHAIAQGHP
DPSSGTIDAPIGRHPKSDWKFAVVAEGRDSITHYDTLEMFPAATLVEVRLETGRTHQIRV
HFSALHHVLVGDITYGADPKLAATVGLKRQWLHAHSLAFKHPGTGEHVQFSSPYPQDLND
ALTILRNS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaactccggtccctaccggttcctgatggactggccggagaacgggtggatgcg
ggcttagcgcgtctgctcggaatgagcaggactgccgtagccgccattattgacggcggc
ggcgtgcagatcgacggcgcagtggtacctcgatcggagcggctcctgccggggagctgg
ctggagatcacgctgccggaactcgagcggcgtcccccagtggtggttgctgatgtcacc
gggttggggcttttgtacgaggacgaggacatcgtcgtcgtggacaaacccgtaggcgtg
gcggcgcattcaagtccagggtgggacggaccaaccgtgaccggcgtgctcgctgcccgc
ggtgtggccgtcgcgagggtcggcgcgcaggagcggcaaggcattgtgcaccggctcgat
gttggcactacgggcgcgatggtggtggctaaaagccaccgggcctacaccgcgctgaag
accgcgttcaaggagcgcacggtggaaaagatctaccatgccatcgcgcaggggcacccc
gacccgtcatcgggcacgatcgacgcccctattggccggcaccccaagtcggattggaaa
ttcgctgtagtggcggaagggcgtgactcgatcacgcactacgacaccctcgaaatgttc
ccggcggcgacgttggtcgaggtccggttggagaccggccgtacccatcaaattcgggtg
catttctcggctctccatcacgttctggtcggcgacatcacctatggcgccgacccgaag
ctggcagctaccgtgggcttgaaaaggcagtggctgcatgcacactcgctggcgtttaag
catcctggaacgggagaacacgtccagttctccagcccgtatccgcaggacctgaatgat
gcgctgaccattcttcgcaacagctga

DBGET integrated database retrieval system