KEGG   Nocardiopsis alba: B005_0131Help
Entry
B005_0131         CDS       T02218                                 

Definition
(GenBank) 2-oxoacid dehydrogenases acyltransferase family protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nal  Nocardiopsis alba
Pathway
nal00020  Citrate cycle (TCA cycle)
nal00310  Lysine degradation
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01130  Biosynthesis of antibiotics
nal01200  Carbon metabolism
Module
nal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B005_0131
  Amino acid metabolism
   00310 Lysine degradation
    B005_0131
Enzymes [BR:nal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B005_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-ProteinID: AFR07682
UniProt: J7LB31
Position
134554..135114
Genome map
AA seq 186 aa AA seqDB search
MDLDFFPFFALAAVEALKAHPEVNAVIDSQAQTVTYHDIENLAISVDTERGLLAPVVKDA
GSLNLGGLARTITDLTERAHTAVLSPDELVGGTFTITDTGHTGALFGTPIINQPQVAILG
AGAVVKRPVVVEDSAMGGEVIAVRSMVYLSMAHDHRLIDSADAGRFLQTVKARLEEGAFE
SELGLA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtggacctggacttcttcccgttcttcgcgctggccgcggtggaggccctcaaggcccac
cccgaggtcaacgcggtgatcgacagccaggcccagacggtgacctaccacgacatcgag
aacctggcgatctcggtggacaccgagcgcggtctgctcgccccggtcgtcaaggacgcc
ggttcgctgaacctgggcggtctggcccggaccatcaccgacctgaccgagcgggcccac
accgccgttctgagcccggacgagctggtcggcggtaccttcaccatcaccgacaccggc
cacaccggcgccctgttcggcaccccgatcatcaaccagccccaggtcgcgatcctgggc
gcgggcgcggtcgtcaagcgcccggtcgtggtcgaggactccgccatgggcggcgaggtc
atcgcggtccggtcgatggtctacctgtcgatggcccacgaccaccgtctgatcgacagc
gccgacgccggccgcttcctccagacggtcaaggcccgtctggaggagggcgccttcgag
agcgagctcggtctggcctga

DBGET integrated database retrieval system