KEGG   Nocardiopsis alba: B005_0241Help
Entry
B005_0241         CDS       T02218                                 

Definition
(GenBank) uroporphyrinogen-III synthase HemD family protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nal  Nocardiopsis alba
Pathway
nal00860  Porphyrin and chlorophyll metabolism
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
Module
nal_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B005_0241
Enzymes [BR:nal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     B005_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C DUF4853
Motif
Other DBs
NCBI-ProteinID: AFR06764
UniProt: J7L7I3
Position
complement(245140..246306)
Genome map
AA seq 388 aa AA seqDB search
MSTVPTTLDDTVSASGSTPSGPLTGFTVAVTAARRAEEIGALLRRKGARVVSAPALRIVP
ISDDRRLASVSDELARRPADIVVATTGIGFRGWIEACETWGVADRLLTGMRGSRLLARGP
KARGALRAAGLTEEWSPNSESSAEVLDHLLAQGIRGLRVAVQLHGEPLPDFTAALRLAGA
EVIEVPVYRWVEPEDTAALDRLIETVVSGGAEAVTFTSAPAAAGLLARAHATGRRADLVH
ALRGDVLAMCVGSVTARPLVAHDIPTVRPERARVGAQIRRLAEELPARYPTLEVAGHHLQ
PRGHAVLVDGVARTLSPTLMRVMRALAHRPGQVLGRARLLTCLGEDADVHAVEAAIARLR
TALGDPRIIRTVVKRGYRLALDAPDRDL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacggtccccaccaccctcgacgacaccgtctccgcgagcgggtccacgccctcc
ggtccactgaccggtttcaccgtggccgtgaccgccgcccgcagagccgaggagatcggc
gccctgctacgccgcaaaggggcccgggtcgtgtccgcccccgctctgcgcatcgtcccg
atcagcgacgaccgacgcctggcctcggtctccgacgaactcgcccgtcgccccgccgac
atcgtcgtggccaccaccggcatcggctttcgcggttggatcgaggcgtgcgagacgtgg
ggcgtcgccgaccgtctcctgaccgggatgcgcggttcacgtctcctggcccgaggcccc
aaggcccgcggcgccctccgcgcggccggtctcaccgaagagtggtcaccgaactcggaa
tcctccgccgaggtcctggaccacctgctcgcccaaggtatccgaggcctgcgcgtggcg
gtccagctgcacggtgaaccgctgccggacttcaccgccgcactgcgcctggccggggcc
gaggtgatcgaggtccccgtctaccgctgggtcgagccggaggacacggccgccctggac
cgtctcatcgagaccgtcgtctccgggggagcggaggccgtcaccttcaccagcgccccc
gccgcggccggactgctcgccagggcccacgccaccggccgccgggccgacctggtccac
gccctgcgcggcgacgtcctggccatgtgcgtggggtcggtcaccgcccgcccgctcgtg
gcgcacgatatccccaccgtccggcccgaacgcgcgcgcgtcggcgcccagatccgcagg
ctcgccgaggagttgccggcccggtaccccactctggaggtggccgggcaccatctccaa
ccgcgaggtcacgccgtcctggtcgacggcgtcgcccgcacgctctctcccaccctgatg
cgcgtcatgagagctctggcgcatcgccccgggcaggtcttgggccgggcccggctgctc
acctgcctgggcgaggacgccgacgtccacgcggtggaggccgccatcgcccgactgcgc
accgccctgggcgacccccggatcatccggaccgtggtcaagcgcggctaccggttggcc
ctggacgcccccgaccgcgacctctga

DBGET integrated database retrieval system