KEGG   Nocardiopsis alba: B005_0816Help
Entry
B005_0816         CDS       T02218                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nal  Nocardiopsis alba
Pathway
nal00260  Glycine, serine and threonine metabolism
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01130  Biosynthesis of antibiotics
nal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B005_0816 (ltaA)
Enzymes [BR:nal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     B005_0816 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AFR07282
UniProt: J7L9X1
Position
832063..833067
Genome map
AA seq 334 aa AA seqDB search
MIDLRSDTLTRPTEEMRRAMAGAEVGDDVWGEDPTVRALEEETAALLGREAALYVPSGHM
ANQLGLYVSTRSGEEVWAHEHHHLIGDEQGAAVVLSRVLPRLYSGDPFPPQELLEKWITG
LGDVHRADPALLWLENTFTGRVVPLEEQRRVTNFAHEHGLLAHLDGARLWNAAIELGVDP
ARVAEGFDTVSVCFSKGLGAPVGSALVGDVDTIRRARRGRKLLGAGMRQAGIIAAGALHA
LRHHRERLAEDHARAAVLAERLSGLPGLEAVARTNMVLLTTAEGEAARYAEAFAEEGVRA
LGGGDRIRMVLSLEVTDSDVEKAAEAITRAVSRL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgcgttcggacaccctgacccgcccgaccgaggagatgcgccgggcgatg
gcgggcgcggaggtcggcgacgacgtgtggggcgaggaccccacggtccgcgcgctggag
gaggagacggccgccctgctgggccgggaggccgccctgtacgtcccctccggccacatg
gccaaccagttggggctgtacgtgtcgacccgcagcggcgaggaggtgtgggcgcacgaa
catcaccacctgatcggcgacgagcagggcgcggccgtggtcctgtcccgtgtgctcccc
cgcctgtactcgggcgacccgttcccgccgcaggagctgctggagaagtggatcaccggc
ctgggcgacgtgcaccgggccgatccggcgttgctgtggctggagaacaccttcaccggc
cgggtcgtgccgctggaggagcagcgtcgggtgacgaacttcgcccatgaacacggcctg
ctcgcccatctggacggggcccggctgtggaacgccgccatcgagctgggggtggacccg
gcccgggtggcggagggcttcgacacggtgtcggtgtgcttctccaagggcctgggcgcc
ccggtggggtcggccctggtgggcgacgtggacacgatccgtcgggcccggcggggccgc
aagctgttgggcgcggggatgcgccaggcggggatcatcgcggcgggcgccctgcacgcg
ctgcgccatcaccgggagcggttggcggaggaccacgcgcgggccgccgtgttggccgag
cgtttgagcggtctaccggggttggaggcggtggcgcggaccaacatggtgctgctgacc
accgccgagggtgaggccgcgcgttacgcggaggccttcgccgaggagggcgtgcgtgct
ctgggcggcggcgatcggatccggatggtgttgagcctggaggtcaccgacagcgacgtc
gagaaggccgccgaggcgatcacccgtgccgtgtcccggttgtga

DBGET integrated database retrieval system