KEGG   Nocardiopsis alba: B005_1828Help
Entry
B005_1828         CDS       T02218                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nal  Nocardiopsis alba
Pathway
nal00010  Glycolysis / Gluconeogenesis
nal00620  Pyruvate metabolism
nal00640  Propanoate metabolism
nal00680  Methane metabolism
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01130  Biosynthesis of antibiotics
nal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_1828
   00620 Pyruvate metabolism
    B005_1828
   00640 Propanoate metabolism
    B005_1828
  Energy metabolism
   00680 Methane metabolism
    B005_1828
Enzymes [BR:nal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     B005_1828
Lipid biosynthesis proteins [BR:nal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   B005_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFR11020
UniProt: J7LHM8
Position
complement(1904077..1905333)
Genome map
AA seq 418 aa AA seqDB search
MWWHEAVGSASTEHTPEAHDAEDPLYIMYTSGTTAKPKGILHTTGGYLTQASYTHWAVFD
LKPETDVYWCAADIGWVTGHSYIVYGPLSNAATVVMYEGTPDTPHKGRFWEIIEKYKVTI
AYMAPTAIRTFMKWGDQIPAEYDLSSLRVIGSVGEPINPEAYVWYRENIGGGRTPVVDTW
WQTETGAIMVSPLPGVTAGKPGAAMRAVPGIVADVVDENGASVPNGEGGFIVIREPWPSM
LRGIWGDDQRYKDTYWSRFEGLYFPGDGAKKDEDGDLWLLGRVDDVMLVSGHNISTTEVE
SALVSHEKVAEAAVVGATDKVTGQSIVGFVILRGGQEEVPEDLVKELRDHVGGSLGPIAK
PARLLAVPELPKTRSGKIMRRLLRDIAENRDIGDTSTLTDASIMDVIAKQLPSTGKAD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtggcacgaggccgtcggttccgcgagcaccgagcacacgcccgaggcccatgac
gccgaggacccgctgtacatcatgtacaccagcggcaccacggccaagcccaagggcatc
ctgcacacgaccggcggctacctcacccaggcctcctacacgcactgggcggtcttcgac
ctcaagcccgagaccgacgtctactggtgcgccgccgacatcggctgggtgaccggtcac
tcctacatcgtctacggtccgctctccaacgccgcgaccgtcgtcatgtacgaggggacc
ccggacaccccgcacaaggggcgcttctgggagatcatcgagaagtacaaggtcaccatc
gcctacatggccccgacggcgatccgtaccttcatgaagtggggcgatcagatccccgcc
gagtacgacctgtcgagcctgcgcgtcatcggctcggtcggcgaaccgatcaaccccgag
gcctacgtctggtaccgggagaacatcggcgggggcaggaccccggtcgtggacacctgg
tggcagaccgagaccggagccatcatggtcagcccgctgcccggcgtcaccgcgggcaag
cccggcgccgccatgcgcgccgtaccgggcatcgtcgccgacgtggtggacgagaacggg
gcgtcggtcccgaacggcgagggcggcttcatcgtcatccgtgagccgtggccgtcgatg
ctccgcggcatctggggcgacgaccaacgctacaaggacacctactggtcgcgcttcgag
ggtctgtacttccccggcgacggcgccaagaaggacgaggacggcgacctgtggctgctc
ggccgcgtggacgacgtcatgctcgtctccggccacaacatctccaccaccgaggtggag
tccgccctggtctcgcacgagaaggtcgccgaggccgcggtcgtcggcgccaccgacaag
gtgaccggccagtcgatcgtcggcttcgtcatcctgcgaggcggccaggaggaggtcccg
gaggacctggtgaaggagctgcgcgaccacgtcggcggttcgctcggcccgatcgccaag
ccggcccgtctgctcgcggtcccggagctgcccaagacccgttccggaaagatcatgcgg
cgcctgctgcgtgacatcgccgagaaccgtgacatcggtgacacctcgaccctcaccgac
gcgtcgatcatggacgtgatcgccaagcagctgccctctacgggcaaggccgactag

DBGET integrated database retrieval system