KEGG   Nocardiopsis alba: B005_2742Help
Entry
B005_2742         CDS       T02218                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nal  Nocardiopsis alba
Pathway
nal00010  Glycolysis / Gluconeogenesis
nal00052  Galactose metabolism
nal00500  Starch and sucrose metabolism
nal00520  Amino sugar and nucleotide sugar metabolism
nal00521  Streptomycin biosynthesis
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01130  Biosynthesis of antibiotics
nal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_2742
   00052 Galactose metabolism
    B005_2742
   00500 Starch and sucrose metabolism
    B005_2742
   00520 Amino sugar and nucleotide sugar metabolism
    B005_2742
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B005_2742
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    B005_2742
Enzymes [BR:nal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     B005_2742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFR07854
UniProt: J7LAM3
Position
2850393..2851436
Genome map
AA seq 347 aa AA seqDB search
MGGAVMVMNAGYGRSLTIGVDVGGTKVAAGVVTPGGRVLARVRTQTPERSKSPEVVEDTI
VSVVSELRRRYPVRAVGVGAAGFVDERRSRVLFAPHLSWREEPLRDALAVRLGLPVVVEN
DANASAWAEVRAGAGRGVDDVVVVNLGTGIGGAIVSDGVLRRGRYGLAGEFGHMTVVPGG
HRCECGNRGCWEQYASGNALTREARELVAAESPVAEALRQEVGGDPTLITGPLVSDLARK
GDRACRELMEEAGTWLGVGLANLAAAFDPELFVIGGGVSEAGGLLLDPARRAFEKGLTGR
GYRPEARVEAAALGNEAGLIGAADLAREALPRGRRRRHRRRLGRVGR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtgcggtcatggtgatgaacgcgggttacggacgttccctgacgatcggtgtg
gacgtcggagggacgaaggtcgccgccggtgtggtgacaccgggtgggagagtcctggcg
cgggtgcgcacccagacgcccgaacgcagcaagagcccggaggtcgtggaggacacgatc
gtctcggtggtgtccgaactccgtcggcggtatccggtacgggcggtgggcgtgggagcg
gccgggttcgtcgacgagcgacgttccagggtcctgttcgccccgcacctgtcctggcgc
gaggagccgctgagggacgccctggcggtacgtctggggctgcccgtggtggtggagaac
gacgccaacgcctcggcctgggccgaggtgcgcgcgggggccggacgcggggtggacgac
gtggtggtcgtcaacctcggcaccgggatcggcggcgcgatcgtctccgacggggtacta
cggcgtggacggtacggtctcgccggagagttcgggcacatgacggtggtgcccggaggc
catcggtgcgaatgcggcaaccggggctgctgggagcagtacgcgagtggcaacgccctc
acccgggaggcccgcgaactggtggccgcggagtcccccgtggcggaggcgctccggcag
gaggtggggggagacccgaccctgatcaccggaccgttggtcagtgacctggcccgcaag
ggcgaccgggcctgtcgggaactgatggaggaggcgggcacctggctgggcgtgggcctg
gccaacctggcggcggccttcgaccccgaactgttcgtgatcggcggtggcgtctccgaa
gcgggagggttgctgctcgatccggcccgacgggccttcgagaagggcctgaccgggcgc
ggctaccggcccgaggcccgggtggaggcggcggcgttgggcaacgaggccggactcatc
ggagccgccgacctcgcgcgtgaggcactgccccggggacggcgccggcgtcaccggcgc
cgtctgggacgcgtcggccggtga

DBGET integrated database retrieval system