KEGG   Nocardiopsis alba: B005_2887Help
Entry
B005_2887         CDS       T02218                                 

Gene name
mca
Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
nal  Nocardiopsis alba
Brite
KEGG Orthology (KO) [BR:nal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B005_2887 (mca)
Enzymes [BR:nal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     B005_2887 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AFR09616
UniProt: J7LAC6
Position
3008701..3009579
Genome map
AA seq 292 aa AA seqDB search
MSERLRLMAVHAHPDDESSKGAATMARYVQEGAEVLVVTMTGGERGDILNPAMERPEIRE
NIAEVRRQEMDRAREILGIEQEFAGFVDSGLPEGDPLPPLPEGCFATLPVEEAAAPLVAA
IRRFRPHVILTYDENGGYPHPDHIMTHKASMHAFDAAPEPEAYPEAGEPWQPLKLYYFVG
FPPERFDALARTLAEHGMENPFEEWAARVKDMERRRWEITTRVHCSEYFEVANDALRAHA
TQIDPNGFWFAVPNEIVAEAWPTEDYHLVRSLVDTEVPEKDLFAGVREAVRV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgagcgcctgcggcttatggccgttcatgcccatcccgatgacgagtccagcaag
ggtgccgccacgatggcgcgctacgtccaagagggcgccgaagtgctggtcgtcaccatg
actggtggtgaacgcggtgacatcctcaaccccgcgatggagcgccccgagatccgagag
aacatcgcggaggtgcgtcgccaggagatggaccgtgcccgcgagatcctcggcatcgag
caggagttcgccgggttcgtcgactccggcctgccggagggcgacccgctgccgcccctg
cccgaagggtgcttcgcgacccttccggtggaggaggccgcggccccgctggtcgcggcg
atccgtcgcttccgtccgcacgtgatcctcacctacgacgagaacggcggctatccgcac
cccgaccacatcatgacccacaaggcgtcgatgcacgccttcgacgccgctcccgagccc
gaggcctaccccgaggcgggggagccctggcagccgctcaagctgtactacttcgtgggc
ttcccccccgagcgcttcgacgccctcgcccggaccctggccgagcacgggatggagaac
ccgttcgaggagtgggccgcccgggtgaaggacatggagcgtcgccggtgggagatcacc
acccgcgtccattgcagcgagtacttcgaggtcgccaacgacgcgcttcgggcgcacgcc
acccagatcgacccgaacggcttctggttcgcggtccccaacgagatcgtcgccgaggcc
tggccgaccgaggactaccacctcgtccgttccctcgtggacacggaggtccctgagaag
gacctcttcgcaggtgtccgcgaggcagtgagagtatga

DBGET integrated database retrieval system