KEGG   Nocardiopsis alba: B005_3584Help
Entry
B005_3584         CDS       T02218                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
nal  Nocardiopsis alba
Pathway
nal00620  Pyruvate metabolism
nal00630  Glyoxylate and dicarboxylate metabolism
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01200  Carbon metabolism
Module
nal_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B005_3584 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    B005_3584 (aceB)
Enzymes [BR:nal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     B005_3584 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFR07532
UniProt: J7LAQ9
Position
complement(3762186..3763790)
Genome map
AA seq 534 aa AA seqDB search
MGATHGVEITGPLNDRFDEILTDDALAFIAELHRAFESRRQELLAARKTREAQIAAGEDL
DFLPETKHIREDDGWKVAPPAPGITDRRVEITGPTDRKMTINALNSGAKVWLADFEDANT
PLWENMIQGQLNLRDALDRAIDFTSPQGKTYALKEDSELATIVVRPRGWHLDEKHILVDG
RRTSGGIVDFALYFFHSAKRQIAKGKGPYFYLPKMQSHLEARLWNDIFVLAQERLEIPRG
TIRATCLIETIPAAFEMEEILYELREHSAGLNAGRWDYLFSIIKTHRTRGRKFLLPERNA
VTMTAPMMRAYTELLVKTCHKRGAHAIGGMAAFIPSRRDEEVNRNAFAKVRDDKSRESGD
GFDGSWVAHPDLVPIAREIFDGVLGDRPNQIDKQRPEVEVTAADLLAVDKTPGGITLAGL
RGNINVALQYLAVWMGGNGAVAIHNLMEDAATAEISRSQIWQWLHNDVTLDDGPKVTVEL
VKQTIEEELAAIKASLGDAYDEDLYKQAKELFTEVALDDDYVDFLTLPAYERMP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccacgcacggggtcgagatcacgggccccctcaacgaccggttcgacgagatc
ctcaccgacgacgccctcgcgttcatcgccgaactgcaccgcgctttcgagtcccgccgc
caggagctgctggccgcgcgtaagacccgcgaggctcagatcgcggccggggaggacctc
gacttcctccccgagaccaagcacattcgcgaggacgacggctggaaggtcgctccgccc
gccccgggcatcacggaccgccgtgtggagatcaccggcccgaccgaccgcaaaatgacc
atcaacgcgctcaactccggcgcgaaggtgtggctggccgacttcgaggacgccaacacc
ccgctgtgggagaacatgatccaggggcagctcaacctgcgcgacgccctggaccgcgcc
atcgacttcacctccccccagggcaagacctacgccctcaaggaggactccgagctcgcc
acgatcgtcgtgcgcccgcgcggctggcacctggacgagaagcacatcctcgtcgacggt
cggcggaccagcggcggcatcgtcgacttcgcgctgtacttcttccacagcgccaagcgt
cagatcgccaagggcaagggcccgtacttctacctgccgaagatgcagagccacctcgag
gcccgtctctggaacgacatcttcgtcctggcccaggagcgtctggagatcccccgcggc
accatccgcgccacctgcctgatcgagaccatcccggccgcgttcgagatggaggagatc
ctctacgagctgcgcgagcactccgccggcctcaacgccggtcgctgggactacctcttc
agcatcatcaagacgcaccgcacccgcggccgcaagttcctgctgcccgagcgcaacgcc
gtcaccatgaccgccccgatgatgcgcgcctacaccgagctgctggtcaagacctgccac
aagcgcggcgcccacgccatcggcggtatggccgccttcatcccctcccgccgggacgag
gaggtcaaccggaacgccttcgccaaggtccgtgacgacaagtcccgcgagtccggcgac
ggcttcgacggctcctgggtcgcgcaccccgacctggtcccgatcgcccgtgagatcttc
gacggcgtcctgggcgacaggcccaaccagatcgacaagcagcgccccgaggtcgaggtg
accgccgccgacctgctcgccgtcgacaagacccccggcgggatcaccctcgccggcctg
cgcggcaacatcaacgtcgccctgcagtacctggccgtgtggatgggcggcaacggcgcg
gtggccatccacaacctcatggaggacgccgccaccgccgagatctcccgctcccagatc
tggcagtggctgcacaacgacgtcaccctcgacgacggccccaaggtcaccgtcgagctg
gtcaagcagaccatcgaggaggagctggccgccatcaaggcctcgctgggcgacgcctac
gacgaggacctgtacaagcaggccaaggagctgttcaccgaggtcgccctggacgacgac
tacgtcgacttcctgacgctgccggcctacgagcgcatgccgtag

DBGET integrated database retrieval system