KEGG   Nocardiopsis alba: B005_4094Help
Entry
B005_4094         CDS       T02218                                 

Gene name
ppgmk
Definition
(GenBank) inorganic polyphosphate/ATP-glucomannokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
nal  Nocardiopsis alba
Pathway
nal00010  Glycolysis / Gluconeogenesis
nal00520  Amino sugar and nucleotide sugar metabolism
nal01100  Metabolic pathways
nal01110  Biosynthesis of secondary metabolites
nal01120  Microbial metabolism in diverse environments
nal01130  Biosynthesis of antibiotics
nal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B005_4094 (ppgmk)
   00520 Amino sugar and nucleotide sugar metabolism
    B005_4094 (ppgmk)
Enzymes [BR:nal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     B005_4094 (ppgmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFR08509
UniProt: J7LCG6
Position
complement(4310014..4310784)
Genome map
AA seq 256 aa AA seqDB search
MSEPTTGLGIDIGGSGIKGAPVDLDSGEFLRDRLKILTPERPGPEAVAAIVAEIADHFPE
AAGTPLGVTFPGVVQNGTVRTAANLPGPWVGTDARALFSQATGRPVRVLNDADAAALAEA
RYGAAKGVLGTVLMTTLGTGIGTALVVDGRLVPNTEFGHLEIDGHDAETRASSGARKRDE
LSYQAWARKRLNRYYRVIEDLLWPDLIVVGGGVSRKADRFLPHLDIRTPIVPATLRNTAG
IVGAALAATEDHARHA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagccgaccacgggcctgggaatcgacatcggcggcagcggtatcaagggggcc
ccggtcgacctggactccggggagttcctccgcgatcgcctcaagatcctcacccccgaa
cgtcccggtcccgaggccgtggcggcgatcgtcgccgagatcgccgaccacttcccggag
gccgcgggcaccccgctcggcgtcaccttccccggcgtggtccagaacgggacggtgcgc
accgccgcgaacctgcccggcccctgggtggggaccgacgcgcgggccctgttctcccag
gccaccgggcggccggtccgcgtgctcaacgacgccgacgccgccgctctggccgaggcc
cgctacggggccgcgaagggcgtactcggcacggtcctgatgacgaccctgggcaccggg
atcggtacggcgctggtggtggacgggcggctggtccccaacaccgagttcggccacctg
gagatcgacgggcacgacgcggagacacgagcctcgtccggcgccaggaaacgggacgag
ttgtcctaccaggcgtgggcccgaaagcgcctgaaccgctactaccgggtgatcgaggac
ctgctgtggcccgacctgatcgtggtcggcggcggggtcagccgcaaggccgaccgtttc
cttccccacctggacatccgcaccccgatcgtgccggcgacgctgcgcaacaccgccggg
atcgtcggcgcggccctggccgcgaccgaggaccacgcccgacacgcctag

DBGET integrated database retrieval system